DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment casp and Ubxn8

DIOPT Version :9

Sequence 1:NP_611080.1 Gene:casp / 36769 FlyBaseID:FBgn0034068 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_001099556.1 Gene:Ubxn8 / 290802 RGDID:1306023 Length:276 Species:Rattus norvegicus


Alignment Length:261 Identity:63/261 - (24%)
Similarity:109/261 - (41%) Gaps:60/261 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   463 MFLSSLTACISSNASLTA--------------RNIKLDKLPAIMLVGKSRQLGSNCEVLSVIHGN 513
            :.|:.||..||...|..:              .|.|..||      .:.||..:..|..|     
  Rat    43 LLLALLTIVISVTTSWFSSLKPPQVHPKEGEEENAKRQKL------ARERQQEAQGEKAS----- 96

  Fly   514 IGLDDLLTRLIETCEMFEEQLQVEIRQEDER-----------AARDQVKAEQDMAYQETLQADMA 567
                    |.|:  .:.:.|.::::::.:||           :...:::.::|..::.:.||...
  Rat    97 --------RYIQ--NVLKPQQEMKLKKLEERFYQMTGETWKLSTGHRLEEDEDSEFENSSQASFE 151

  Fly   568 K---DAAKRQKEAAQLAERKRMESERAEEDARRESIRLVAQQSLPQEPSEQETGTSKIRVRKPTG 629
            .   :||:||.....|.|    .|..|:..:|:|      ...||:||||...|...:.:|.|:|
  Rat   152 TVNGEAARRQNLPKFLTE----ISPPAQPPSRKE------VPDLPEEPSETAEGVVTVALRCPSG 206

  Fly   630 DFLERRFFINNNLQDLLNFVTANGFLIEEYKLISSWPRRDLTAIESSQTLESLKLYPQETVILEE 694
            ..|.||||.:.|.|.|.:::...|:....|.|.:|:|||.| .:....:||.:.:.....:.:||
  Rat   207 HLLRRRFFKSWNSQVLFDWMMKIGYHRSLYGLSTSFPRRPL-EVGGGSSLEDIGITVDTVLNVEE 270

  Fly   695 R 695
            |
  Rat   271 R 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caspNP_611080.1 UBA_FAF1 12..44 CDD:270596
UBL 148..>182 CDD:176364
UAS_FAF1 392..530 CDD:239288 16/80 (20%)
Faf1_UBX 616..695 CDD:176366 23/78 (29%)
Ubxn8NP_001099556.1 UBQ 191..270 CDD:294102 23/79 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1363
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.