DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment casp and ubc-23

DIOPT Version :9

Sequence 1:NP_611080.1 Gene:casp / 36769 FlyBaseID:FBgn0034068 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_509498.4 Gene:ubc-23 / 182989 WormBaseID:WBGene00006718 Length:395 Species:Caenorhabditis elegans


Alignment Length:353 Identity:87/353 - (24%)
Similarity:157/353 - (44%) Gaps:83/353 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 VDSESSTDEFEDATDFNNAEY---------------------IFTDSPPAQPPNRHLIPNDTDDE 370
            ||::..:.:     ||.|.||                     ::..:||...|: |..|  ..|.
 Worm    67 VDNQRGSRD-----DFGNDEYDNNGIGGTANILNDEVGESSTLYQVAPPLMMPH-HSQP--IPDA 123

  Fly   371 ISGSTQFVENYKARY---GEPCPEFFVGSLENAKQLACLRSAKER------KLLAIYLHHGKS-- 424
            :.   .:.:|:..||   ....|:|:..:|.||     ::.|.::      :.||.::::..|  
 Worm   124 LK---CYTDNFNTRYQIGSTVMPKFYTDTLRNA-----VKEAFDQENPILCRPLAFFINNENSSN 180

  Fly   425 ---ILSNVFCDQLMKHESIIQTFKEKFVLYGWDMTYESNKDMFLSSLTACISSNASLTARNIK-- 484
               .::||.|::|:  .|.:.|   |::||.||:|...|.|.||..||   .||.|....|:|  
 Worm   181 TRNFVTNVLCNELV--TSYLAT---KYILYPWDVTEPRNLDRFLRILT---DSNMSSMHYNLKSF 237

  Fly   485 ----LDKLPAIMLVGKSRQLGSNCEVLSVIHGNIGLDDLLTRLIETC-EMFEEQLQVEIRQEDER 544
                ..:.|.|.:|.:.   |:..||:..::|...|::::..|.|.. |:.||:|:|..:|.:.:
 Worm   238 NESESHRFPYIAIVLRK---GNWFEVIREVNGTSDLNEVVNALYEGFEELQEEKLRVLSKQVERK 299

  Fly   545 AARDQVKAE------QDMAYQETLQADMAKDAAKRQKEAAQLAERKRMESERAEEDARRESIRL- 602
            ..:.:|:.|      |:..|.:.|:.|......||      :|.:..:|:.|.|...:...::: 
 Worm   300 TKQAKVEEERKLIDQQNEVYYKNLKIDTDNLNKKR------IAAKSEIETTRPETKPKITPMKVI 358

  Fly   603 -VAQQSLPQEPSEQETGTSKIRVRKPTG 629
             |..|:||:||:..||....::.|.|.|
 Worm   359 SVTPQNLPEEPNVSETNIVTVKFRLPKG 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caspNP_611080.1 UBA_FAF1 12..44 CDD:270596
UBL 148..>182 CDD:176364
UAS_FAF1 392..530 CDD:239288 42/155 (27%)
Faf1_UBX 616..695 CDD:176366 5/14 (36%)
ubc-23NP_509498.4 UBA_4 13..54 CDD:373127
UAS 125..278 CDD:214737 43/171 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166125
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1363
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D363568at33208
OrthoFinder 1 1.000 - - FOG0006030
OrthoInspector 1 1.000 - - otm14391
orthoMCL 1 0.900 - - OOG6_107273
Panther 1 1.100 - - O PTHR23322
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2328
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.