DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment casp and Ubxn8

DIOPT Version :9

Sequence 1:NP_611080.1 Gene:casp / 36769 FlyBaseID:FBgn0034068 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_848763.2 Gene:Ubxn8 / 108159 MGIID:1337129 Length:277 Species:Mus musculus


Alignment Length:190 Identity:50/190 - (26%)
Similarity:89/190 - (46%) Gaps:28/190 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   521 TRLIETCEMFEEQLQVEIRQEDER------------AARDQVKAEQDMAYQETLQADMAK---DA 570
            :|.||  .:.:.|.::::::.:||            |....::.::|..::.:.||....   :|
Mouse    96 SRYIE--NVLKPQQEMKLKKLEERFYQMTGETWKLTAGHRLLEGDEDSEFENSSQASFETINGEA 158

  Fly   571 AKRQKEAAQLAERKRMESERAEEDARRESIRLVAQQSLPQEPSEQETGTSKIRVRKPTGDFLERR 635
            |:||    .|.:.....|..|....|:|      ...||:||||.......:.:|.|.|..|.||
Mouse   159 ARRQ----NLPKFSTEISPAARPLLRKE------VPDLPEEPSETAEEVVTVALRCPNGRVLRRR 213

  Fly   636 FFINNNLQDLLNFVTANGFLIEEYKLISSWPRRDLTAIESSQTLESLKLYPQETVILEER 695
            ||.:.|.|.||:::...|:....|:|.:|:|||.| .:|...:||.:.:.....:.:||:
Mouse   214 FFKSWNSQVLLDWMMKVGYHKSLYRLSNSFPRRAL-EVEGGSSLEDIGITVDTVLNVEEK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
caspNP_611080.1 UBA_FAF1 12..44 CDD:270596
UBL 148..>182 CDD:176364
UAS_FAF1 392..530 CDD:239288 3/8 (38%)
Faf1_UBX 616..695 CDD:176366 24/78 (31%)
Ubxn8NP_848763.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 64..89
UBQ 192..271 CDD:294102 24/79 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1363
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.