DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8399 and AT5G47530

DIOPT Version :9

Sequence 1:NP_001286472.1 Gene:CG8399 / 36768 FlyBaseID:FBgn0034067 Length:656 Species:Drosophila melanogaster
Sequence 2:NP_199564.1 Gene:AT5G47530 / 834803 AraportID:AT5G47530 Length:395 Species:Arabidopsis thaliana


Alignment Length:346 Identity:83/346 - (23%)
Similarity:129/346 - (37%) Gaps:58/346 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 KSCTSITVVTVRGDVF---EFEIQSG---------KGTNAAYV--AVGLSDDAKMGDDLTTECVP 296
            :||..:.|:    |.|   .::..||         |.|...:|  ||..:....:|.........
plant    39 ESCNDLPVL----DSFLHYTYDSSSGNLQIAYRHTKLTPGKWVAWAVNPTSTGMVGAQAIVAYPQ 99

  Fly   297 ENGRVNLYSSLTSASPYSAVRS----NVNQNSARLLDASIVDGVIYCRVQRDAVTNVQGRTFDLR 357
            .:|.|..|:|..|:...|.:.:    ||:|.||...:..:   |||      |:.|:     .|.
plant   100 SDGTVRAYTSPISSYQTSLLEAELSFNVSQLSATYQNNEM---VIY------AILNL-----PLA 150

  Fly   358 NGKYHLLVASGSSLKENSVGYHDI--GRLPSAQPINLAEVQDLSGS--------SRLLIQ-LHGA 411
            ||.....|....||..|:...|..  ..:.|...:||  |...|||        |:|..: :||.
plant   151 NGGIINTVWQDGSLSGNNPLPHPTSGNNVRSVSTLNL--VSGASGSTSTGAGGASKLRKRNIHGI 213

  Fly   412 FMIAAWIGTTSLGIIFARYFKQTWVGSQSCGTDQWFAWHRLLMVTTWSLTVAAY---VLIWVELK 473
            ....:|.....:|.|.|||.|.:     ......||..|.....:.:.:.||.:   :.:..|..
plant   214 LNGVSWGIMMPIGAIIARYLKVS-----KSADPAWFYLHVFCQSSAYIIGVAGWATGLKLGNESA 273

  Fly   474 QAVWHAHSIIGLITVILCFIQPIGALFRPGPNDKKRPYFNWGHWLGGNLAHILGIVTIFFSVKLP 538
            ...:..|..:|:....|..||......||.|..|.|.|:|..|...|....||.:|.:|..:.:.
plant   274 GIQFTFHRAVGIALFCLATIQVFAMFLRPKPEHKYRVYWNIYHHTVGYSVIILAVVNVFKGLDIL 338

  Fly   539 KAELPEWMDWILVSFVVVHVL 559
            ..| .:|.:......||:.::
plant   339 SPE-KQWRNAYTAIIVVLGIV 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8399NP_001286472.1 Reeler 40..170 CDD:280232
DOMON_SDR_2_like 223..392 CDD:187686 38/165 (23%)
Cyt_b561_FRRS1_like 358..553 CDD:176490 51/208 (25%)
AT5G47530NP_199564.1 DOMON_CIL1_like 38..189 CDD:187687 40/169 (24%)
Cyt_b561_FRRS1_like 181..363 CDD:176490 46/186 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D599276at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.