DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8399 and AT5G35735

DIOPT Version :9

Sequence 1:NP_001286472.1 Gene:CG8399 / 36768 FlyBaseID:FBgn0034067 Length:656 Species:Drosophila melanogaster
Sequence 2:NP_568531.1 Gene:AT5G35735 / 833550 AraportID:AT5G35735 Length:404 Species:Arabidopsis thaliana


Alignment Length:328 Identity:75/328 - (22%)
Similarity:123/328 - (37%) Gaps:69/328 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 GTNA-AYVAVGLSDDAKMGDDLTTECVPENGRVNLYSSLTSASPYSAVRSNVNQNSARL------ 327
            ||:| ::||.||:..       :|:.|.....|...:  |:.:.:.|..|:|:....||      
plant    72 GTSASSWVAWGLNPS-------STQMVGTQALVAFTN--TTTNQFQAYTSSVSSYGTRLERSSLS 127

  Fly   328 -----LDASIVDG--VIYCRVQRD---AVTNVQGRTFDLRNGKYHLLVASGSSLKENSVGYHDIG 382
                 |.|::|.|  .|:..::..   ...|...:...:.||.......||.:::.:       |
plant   128 FGVSGLSATLVSGEVTIFATLELSPNLITANQLWQVGPVVNGVPASHQTSGDNMRSS-------G 185

  Fly   383 RLPSAQPINLAEVQDLSG----SSRLLIQ-LHGAFMIAAWIGTTSLGIIFARYFKQTWVGSQSCG 442
            |      |:....|..:|    ..||..: .||.....:|.....:|.:.|||.|       ...
plant   186 R------IDFRTGQASAGGGGSGDRLRKRNTHGVLNAVSWGVLMPMGAMMARYMK-------VFA 237

  Fly   443 TDQWFAWHRLLMVTTWSLTVAAY---VLIWVELKQAVWHAHSIIGLITVILCFIQPIGALFRPGP 504
            ...||..|....|:.:.:.||.:   :.:..:.....:..|..:|:.......:|....|.||.|
plant   238 DPTWFYLHIAFQVSGYVIGVAGWATGIKLGNDSPGTSYSTHRNLGIALFTFATLQVFALLVRPKP 302

  Fly   505 NDKKRPYFNWGHWLGGNLAHILGIVTIF--FSVKLPKAELPEWMDWILVSFVVVHVLVHLIFSIG 567
            :.|.|.|:|..|...|....||.||.||  |.:..|:   .:|. |..:..        ||| :|
plant   303 DHKYRTYWNVYHHTVGYTTIILSIVNIFKGFDILDPE---DKWR-WAYIGI--------LIF-LG 354

  Fly   568 LCL 570
            .|:
plant   355 ACV 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8399NP_001286472.1 Reeler 40..170 CDD:280232
DOMON_SDR_2_like 223..392 CDD:187686 29/138 (21%)
Cyt_b561_FRRS1_like 358..553 CDD:176490 48/204 (24%)
AT5G35735NP_568531.1 DOMON_CIL1_like 40..191 CDD:187687 29/140 (21%)
Cyt_b561_FRRS1_like 188..361 CDD:176490 46/190 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D599276at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.