DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8399 and AT4G18260

DIOPT Version :10

Sequence 1:NP_001286472.1 Gene:CG8399 / 36768 FlyBaseID:FBgn0034067 Length:656 Species:Drosophila melanogaster
Sequence 2:NP_193560.2 Gene:AT4G18260 / 827552 AraportID:AT4G18260 Length:284 Species:Arabidopsis thaliana


Alignment Length:145 Identity:41/145 - (28%)
Similarity:58/145 - (40%) Gaps:29/145 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 DLSQNQLTHIELDVLGAMRRLRDLDLSVNQIARLDASPELQLAGLRNLWVSYNRLRSFGAFPGAF 228
            |||||.:.....::..:.:.|:...|.::.....|   .:.|| |:|..||.  :.:.|:  |||
plant   269 DLSQNPIQSSSDEITLSFKTLQRNGLMLHTGKSAD---YVNLA-LKNGAVSL--VINLGS--GAF 325

  Fly   229 PAL-DTV--RLIGNRWHCGWVDR----------ARADIMRHGI-TAFG---ADYDCPGERQ---- 272
            .|| :.|  :...|.||...|.|          |...|...|| |..|   .||...|...    
plant   326 EALVEPVNGKFNDNNWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYV 390

  Fly   273 GGLCCYDDVPGEVVA 287
            ||.....|:||..|:
plant   391 GGSPSTADLPGSPVS 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8399NP_001286472.1 Reeler 40..170 CDD:460411 5/5 (100%)
DOMON_SDR_2_like 223..392 CDD:187686 26/86 (30%)
Cyt_b561_FRRS1_like 358..553 CDD:176490
AT4G18260NP_193560.2 Cyt_b561_FRRS1_like 28..223 CDD:176490
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.