DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8399 and AT3G59070

DIOPT Version :9

Sequence 1:NP_001286472.1 Gene:CG8399 / 36768 FlyBaseID:FBgn0034067 Length:656 Species:Drosophila melanogaster
Sequence 2:NP_191466.1 Gene:AT3G59070 / 825076 AraportID:AT3G59070 Length:466 Species:Arabidopsis thaliana


Alignment Length:242 Identity:59/242 - (24%)
Similarity:100/242 - (41%) Gaps:32/242 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 VNLYSSLTSASPYSAVRSNVNQNSARLLDASIVDGVIYCRVQRDAVTNVQGRTFDLRNG-KYHLL 364
            :|.||.:...||.|.   .|.|.||...:..::............|.|...:...|:.| :..:.
plant   122 INSYSPMLQESPLSL---RVTQVSAEYSNGEMMIFATLVLPPNTTVVNHLWQDGPLKEGDRLGMH 183

  Fly   365 VASGSSLKENSVGYHDI--GRLPSAQPINLAEVQDLSGSSRLLI-QLHGAFMIAAWIGTTSLGII 426
            ..||.:||  |:...|:  |::.:.:.:|         .:.||: |:|......:|.....:|::
plant   184 AMSGDNLK--SMASLDLLSGQVTTTKSVN---------RNMLLVKQIHAIVNALSWGILMPIGVM 237

  Fly   427 FARYFKQTWVGSQSCGTDQWFAWHRLLMVTTW------SLTVAAYVLIWVELKQAVWHAHSIIGL 485
            .|||.|...|...:     ||..|.:...|.:      .|..|.|:.....::..:   |::|||
plant   238 AARYMKNYEVLDPT-----WFYIHVVCQTTGYFSGLIGGLGTAIYMARHTGMRTTL---HTVIGL 294

  Fly   486 ITVILCFIQPIGALFRPGPNDKKRPYFNWGHWLGGNLAHILGIVTIF 532
            :...|.|:|.:....||..:.|.|.|:||.|...|.:..:|.|..|:
plant   295 LLFALGFLQILSLKARPNKDHKYRKYWNWYHHTMGYIVIVLSIYNIY 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8399NP_001286472.1 Reeler 40..170 CDD:280232
DOMON_SDR_2_like 223..392 CDD:187686 21/93 (23%)
Cyt_b561_FRRS1_like 358..553 CDD:176490 46/185 (25%)
AT3G59070NP_191466.1 DOMON_CIL1_like 48..200 CDD:187687 20/82 (24%)
Cyt_b561_FRRS1_like 190..373 CDD:176490 43/171 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D599276at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.