DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8399 and AT3G25290

DIOPT Version :9

Sequence 1:NP_001286472.1 Gene:CG8399 / 36768 FlyBaseID:FBgn0034067 Length:656 Species:Drosophila melanogaster
Sequence 2:NP_001030764.1 Gene:AT3G25290 / 822123 AraportID:AT3G25290 Length:393 Species:Arabidopsis thaliana


Alignment Length:310 Identity:70/310 - (22%)
Similarity:111/310 - (35%) Gaps:85/310 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 PENG-------RVNLYSSLTSASPYSAVRSNVNQNSARLLDASIVDG---VIYCRVQRDAVTNVQ 350
            |.||       .::.||||..:.....|.....:.:||       ||   .|:.||:..|....:
plant   101 PGNGVAVVKTLNISSYSSLIPSKLAFDVWDMKAEEAAR-------DGGSLRIFARVKVPADLVAK 158

  Fly   351 GR--------------------TFDLRNGKYHLLVASGSS--LKENSVGYHDIGRLPSAQPINLA 393
            |:                    .||..|      :||.||  ||.::.|    |.:.....:| |
plant   159 GKVNQVWQVGPELGPGGMIGRHAFDSAN------LASMSSLDLKGDNSG----GTISGGDEVN-A 212

  Fly   394 EVQDLSGSSRLLIQLHGAFMIAAWIGTTSLGIIFARYFKQTWVGSQSCGTDQWFAWHRLLMVTTW 458
            ::::.:        :||.....:|.....:|.|.|||.:..     ......||..|.....:.:
plant   213 KIKNRN--------IHGILNAVSWGILFPIGAIIARYMRVF-----DSADPAWFYLHVSCQFSAY 264

  Fly   459 SLTVAAY---VLIWVELKQAVWHAHSIIGLITVILCFIQPIGALFRPGPNDKKRPYFNWGHWLGG 520
            .:.||.:   :.:..|.:...:.||..||:....|..||....|.||..:.|.|.|:|..|...|
plant   265 VIGVAGWATGLKLGNESEGIRFSAHRNIGIALFTLATIQMFAMLLRPKKDHKYRFYWNIYHHGVG 329

  Fly   521 NLAHILGIVTIFFSVKLPK-------------------AELPEWMDWILV 551
            .....|||:.:|..:.:.|                   |.|.|.:.|::|
plant   330 YAILTLGIINVFKGLNILKPQDTYKTAYIAVIAVLGGIALLLEAITWVVV 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8399NP_001286472.1 Reeler 40..170 CDD:280232
DOMON_SDR_2_like 223..392 CDD:187686 28/127 (22%)
Cyt_b561_FRRS1_like 358..553 CDD:176490 51/218 (23%)
AT3G25290NP_001030764.1 DOMON_CIL1_like 39..195 CDD:187687 24/106 (23%)
Cyt_b561_FRRS1_like 187..373 CDD:176490 47/203 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D599276at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.