DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8399 and AT3G07570

DIOPT Version :9

Sequence 1:NP_001286472.1 Gene:CG8399 / 36768 FlyBaseID:FBgn0034067 Length:656 Species:Drosophila melanogaster
Sequence 2:NP_566313.2 Gene:AT3G07570 / 819948 AraportID:AT3G07570 Length:369 Species:Arabidopsis thaliana


Alignment Length:299 Identity:72/299 - (24%)
Similarity:111/299 - (37%) Gaps:67/299 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 NAAYVAVGLSDDAKM-GDDLTTECVPENGRVNLYSSLTSASPY-----SAVRSNVNQNSARLLDA 330
            ::|::.:|.|.:.:| |.......:|.:|      ...:..||     |....|.:|....:::.
plant    78 SSAFIGIGFSTNGQMIGSSAIVGWIPSDG------GSGTVKPYLLGGKSPGEVNPDQGDLTIVNG 136

  Fly   331 SI----VDGVIYCRVQRDAVTNVQGRTFDLRNGKYHLLVASGSSLKENSVGYHDIGRLPSAQPIN 391
            |:    |...:|.|.|..|....|.           ||.|.|.:           |..||:....
plant   137 SLKIESVSSRLYMRFQLTATLPRQS-----------LLYAVGPA-----------GFFPSSPDFR 179

  Fly   392 LAE-----------------VQDLSGSSRLLIQLHGAFMIAAWIGTTSLGIIFARYFKQTWVGSQ 439
            |.|                 |..:|..|:|. :.||...:..|.....:|.|.||:.|| |    
plant   180 LREHRFVTTTTINYNTGSQSVVKVSPHSKLK-KTHGLMNMFGWGILIIVGAIVARHMKQ-W---- 238

  Fly   440 SCGTDQWFAWHRLLMVTTWSLTVAAYV---LIWVELKQAVWHAHSIIGLITVILCFIQPIGALFR 501
               ...||..|..|..|.:.|.:...:   ::...||......|..:|:..:::..:|.:..|.|
plant   239 ---DPTWFYAHIALQTTGFLLGLTGVICGLVLENRLKANNVSKHKGLGITILVMGVLQMLALLAR 300

  Fly   502 PGPNDKKRPYFNWGHWLGGNLAHILGIVTIFFSVKLPKA 540
            |....|.|.|:||.|...|.|..||.|..||:.:.|.||
plant   301 PDKQSKYRKYWNWYHHNIGRLLIILAISNIFYGIHLAKA 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8399NP_001286472.1 Reeler 40..170 CDD:280232
DOMON_SDR_2_like 223..392 CDD:187686 26/129 (20%)
Cyt_b561_FRRS1_like 358..553 CDD:176490 53/203 (26%)
AT3G07570NP_566313.2 DoH 54..198 CDD:214768 28/147 (19%)
Cyt_b561_FRRS1_like 187..363 CDD:176490 44/162 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D599276at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto4134
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.