DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8399 and AT2G04850

DIOPT Version :9

Sequence 1:NP_001286472.1 Gene:CG8399 / 36768 FlyBaseID:FBgn0034067 Length:656 Species:Drosophila melanogaster
Sequence 2:NP_565316.1 Gene:AT2G04850 / 815031 AraportID:AT2G04850 Length:404 Species:Arabidopsis thaliana


Alignment Length:346 Identity:74/346 - (21%)
Similarity:121/346 - (34%) Gaps:86/346 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 PENGRVNLYSSLTSASPYSAVRSNVN------------------QNSARL------LDASI---- 332
            |.|..::|....|..||...|...:|                  .||.:|      ||:|:    
plant    53 PHNATLDLCFFGTFISPSGWVGWGINPDSPAQMTGSRVLIAFPDPNSGQLILLPYVLDSSVKLQK 117

  Fly   333 -------VDGVIYCRVQRDAVTNVQGRTFDLRNGKYHLLVASGSSLKENSVGYHDI--------G 382
                   :|.|   |:...:.:...|:...:|||....:.|| ..|..|:...|.:        |
plant   118 GPLLSRPLDLV---RLSSSSASLYGGKMATIRNGASVQIYAS-VKLSSNNTKIHHVWNRGLYVQG 178

  Fly   383 RLPSAQPINLAEVQDLS--------------GSSRLLIQLHGAFMIAAWIGTTSLGIIFARYFKQ 433
            ..|:..|....::...|              ..||.|...||.....:|......|.:.|||.:|
plant   179 YSPTIHPTTSTDLSSFSTFDVTSGFATVNQNSGSRALKVTHGVVNAISWGFLLPAGAVTARYLRQ 243

  Fly   434 TWVGSQSCGTDQWFAWHRLLMVTTWSLTVAAY---VLIWVELKQAVWHAHSIIGLITVILCFIQP 495
                .||.| ..||..|..:.:|.:.|....:   :::........:..|..:|:.|.....:|.
plant   244 ----MQSIG-PTWFYIHAAIQLTGFLLGTIGFSIGIVLGHNSPGVTYGLHRSLGIATFTAAALQT 303

  Fly   496 IGALFRPGPNDKKRPYFNWGHWLGGNLAHILGIVTIF--FSVKLPKAELPEWMDWILVSFVVVHV 558
            :..||||...:|.|.|:...|...|....::|:|.:|  |.|      |.|...:..:.:.:.  
plant   304 LALLFRPKTTNKFRRYWKSYHHFVGYACVVMGVVNVFQGFEV------LREGRSYAKLGYCLC-- 360

  Fly   559 LVHLIFSIGLC----LNHWQI 575
               |...:|:|    :|.|.:
plant   361 ---LSTLVGVCVAMEVNSWVV 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8399NP_001286472.1 Reeler 40..170 CDD:280232
DOMON_SDR_2_like 223..392 CDD:187686 29/138 (21%)
Cyt_b561_FRRS1_like 358..553 CDD:176490 50/221 (23%)
AT2G04850NP_565316.1 DOMON_CIL1_like 34..201 CDD:187687 30/151 (20%)
Cyt_b561_FRRS1_like 191..373 CDD:176490 43/197 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D599276at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.