DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8399 and M03A1.8

DIOPT Version :9

Sequence 1:NP_001286472.1 Gene:CG8399 / 36768 FlyBaseID:FBgn0034067 Length:656 Species:Drosophila melanogaster
Sequence 2:NP_001122624.1 Gene:M03A1.8 / 6418630 WormBaseID:WBGene00077490 Length:382 Species:Caenorhabditis elegans


Alignment Length:393 Identity:91/393 - (23%)
Similarity:155/393 - (39%) Gaps:84/393 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 DLTTECVPENGRVNLYSSLTSASPYSAVRSNVNQNSARLLD--------ASIVDGVIYCRVQRDA 345
            ::|..|...:|.::|  ...:....|||:.   .|...||:        :|.:|...| :::...
 Worm    34 NITVTCNKNDGFMSL--KWKTEEKRSAVKI---YNGVNLLEFVCGFPIGSSNIDVKTY-KLETLK 92

  Fly   346 VTNVQGRTFDLRNGKYHLLVASGSSLK---ENS--VGYHDIGRLPSAQPINLAEVQDLSGS-SRL 404
            ..|:.....|...|.. ||::..||||   |.|  ..:|:|     ..|    :::.||.. .||
 Worm    93 SENLTSCEIDFYPGDV-LLMSESSSLKWSNEKSEFFNFHEI-----CNP----KIEGLSKEFKRL 147

  Fly   405 LIQLHGAFMIAAWIGTTSLGIIFARYFKQTWVGSQSCGTDQWFAWHR----------------LL 453
            |::||...||..|:.....|.:||||.:|.:......|...||..||                :|
 Worm   148 LVKLHAILMILGWLFFVPTGFLFARYGRQVFKNHTIYGMFVWFQIHRASTFIGVCCIVTSILCIL 212

  Fly   454 MVTTWSLTVAAYVLIWVELKQAVWH---AHSIIGLITVILCFIQPIGALFRPGPNDKKRPYFNWG 515
            :.|.|:         |.......|:   .|:..|.|:.||.|.||:.:|.|..|::.:|..|||.
 Worm   213 ISTNWT---------WKGTGSEAWYWTQWHTDFGTISTILAFSQPLNSLLRCPPSNSQRSIFNWA 268

  Fly   516 HWLGGNLAHILGIVTIFF-SVKLPKAELPEWMDWILVSFVVVHVLVHLIFSIGLCLNHWQIGGMA 579
            |.:.|.|::...:..|:. :....|......|:.:|.|...:     |..:.|..:.:.:     
 Worm   269 HRIVGLLSYTFAVAAIYVAAANYRKTWSEPTMEIVLTSVPTI-----LCIATGFVVLYLE----- 323

  Fly   580 SERHLSQRANTFQMGDMSHHQQHAMRNGMSMERKMDAPYAGMRKGLLGVYGVVLILFVTVLILLV 644
                 |::.|.::..:|....:   :|....||......:.|       :.||.|.|...:.|.:
 Worm   324 -----SEQRNGYREVEMIEKSE---KNSKKPERLQLIQISWM-------FAVVGICFGVAISLSL 373

  Fly   645 VLA 647
            ::|
 Worm   374 LIA 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8399NP_001286472.1 Reeler 40..170 CDD:280232
DOMON_SDR_2_like 223..392 CDD:187686 27/115 (23%)
Cyt_b561_FRRS1_like 358..553 CDD:176490 60/220 (27%)
M03A1.8NP_001122624.1 B561 151..279 CDD:214769 39/136 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156354
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D464310at33208
OrthoFinder 1 1.000 - - FOG0001198
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.