DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8399 and C29F5.8

DIOPT Version :9

Sequence 1:NP_001286472.1 Gene:CG8399 / 36768 FlyBaseID:FBgn0034067 Length:656 Species:Drosophila melanogaster
Sequence 2:NP_001033329.1 Gene:C29F5.8 / 3896730 WormBaseID:WBGene00044589 Length:217 Species:Caenorhabditis elegans


Alignment Length:151 Identity:41/151 - (27%)
Similarity:63/151 - (41%) Gaps:17/151 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 CGQSKNCFGFPDGCVATKSC-TSITVVTVRGDVFEFEIQSGKGTNAAYVAVGLSDDAKMGDDLTT 292
            ||.::.|:..|:||.....| |.:|....|..:. .||:|.......::..|.|.|..||:|...
 Worm    25 CGTARGCWKLPNGCKDASDCQTMMTWKHERRHLI-IEIESKLVKPDMWLGFGFSKDGLMGNDTVF 88

  Fly   293 EC-VPENGRVNLYSSLTSASPYSAVRSNVNQNSARLL----DASIVDGVIYCR---VQRDAVTNV 349
            || .|.:|     |.....|..:|.|:.|.:.::.||    .....||...|.   :..:.....
 Worm    89 ECQFPASG-----SGSVLISHNTAKRNIVLKTASELLIRDGYTEFNDGKAMCGGEWILDNIHLGT 148

  Fly   350 QGRTF--DLRNGKYHLLVASG 368
            :.||.  .:.:|:|||..|.|
 Worm   149 EERTLMHVISSGRYHLFFAYG 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8399NP_001286472.1 Reeler 40..170 CDD:280232
DOMON_SDR_2_like 223..392 CDD:187686 41/151 (27%)
Cyt_b561_FRRS1_like 358..553 CDD:176490 6/11 (55%)
C29F5.8NP_001033329.1 DOMON_SDR_2_like 20..190 CDD:187686 41/151 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D599276at2759
OrthoFinder 1 1.000 - - FOG0001198
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.