DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8399 and nahoda

DIOPT Version :9

Sequence 1:NP_001286472.1 Gene:CG8399 / 36768 FlyBaseID:FBgn0034067 Length:656 Species:Drosophila melanogaster
Sequence 2:NP_523815.2 Gene:nahoda / 37641 FlyBaseID:FBgn0034797 Length:1335 Species:Drosophila melanogaster


Alignment Length:227 Identity:52/227 - (22%)
Similarity:90/227 - (39%) Gaps:53/227 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 AVSSDPIYNGCGQS---KNCFG---FPDGCVATK-SC---TSITVVTVRGDVFEFEIQSGKGTNA 273
            |.|:|  .|..|.:   .:|:|   :|..|...: :|   .|...|. :||...:.|::  ....
  Fly   733 ATSTD--RNDLGTNVLDNDCYGHWKYPSNCSPQEHTCEYYASWETVG-KGDEMRWHIET--SNTQ 792

  Fly   274 AYVAVGLSDDAKMGDDLTTECV-----PENGRVNLYSS--LTSASPYSAVRSNVNQNSARLLDAS 331
            .:..:|.|||.:|..   |:.:     ..:||..|..:  |..|.|....|.::...|.|     
  Fly   793 TWTGIGFSDDQRMSQ---TDAIIGWVDGRSGRPFLMDTWVLGYAPPKLDDRQDIYNASGR----- 849

  Fly   332 IVDGVIYCRVQRDAVTNVQGRTFDLRNGKYHLL-----VASGS-SLKENSVGYHDIGRLPSAQPI 390
            |..||......|..|:|.:.   ||.....|.|     |..|: ::....:..|:  ::|   ||
  Fly   850 IEKGVTILEFNRKRVSNDEQ---DLSFTDDHCLYLFFPVLGGAFNVVNKKIRKHE--QVP---PI 906

  Fly   391 NLAEVQDLSGSSRLLIQLHGAFMIAAWIGTTS 422
            :         |.|:.|:..|..:.:.::||::
  Fly   907 S---------SQRVCIKSCGKELESVFVGTST 929

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8399NP_001286472.1 Reeler 40..170 CDD:280232
DOMON_SDR_2_like 223..392 CDD:187686 44/191 (23%)
Cyt_b561_FRRS1_like 358..553 CDD:176490 14/71 (20%)
nahodaNP_523815.2 Chitin_bind_3 36..162 CDD:281112
EGF_2 202..238 CDD:285248
DOMON_like 255..>297 CDD:301346
DOMON_DOH <593..693 CDD:187689
DOMON 765..884 CDD:281361 31/132 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4293
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.