DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8399 and Frrs1l

DIOPT Version :9

Sequence 1:NP_001286472.1 Gene:CG8399 / 36768 FlyBaseID:FBgn0034067 Length:656 Species:Drosophila melanogaster
Sequence 2:XP_345536.7 Gene:Frrs1l / 366376 RGDID:1309978 Length:293 Species:Rattus norvegicus


Alignment Length:229 Identity:60/229 - (26%)
Similarity:97/229 - (42%) Gaps:24/229 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 RRDLSAAPPLPTQSPSAPAGTTRAPYVPPSYVAPNNVVAVSSDPI-------YNGCGQSKNCF-- 236
            |.|..|...:|....|  .||....:....|::.......::.|:       ...||::|.||  
  Rat    47 RGDAGADEAVPRHDSS--YGTFAGEFYDLRYLSEEGYPFPTAPPVDPFAKIKVEDCGRTKGCFRY 109

  Fly   237 GFPDGCVATKSCTSITVVTVRGDVFEFEIQSGKGTNAAYVAVGLSDDAKMGDDLTTECV-PENGR 300
            |.| ||.| ::|.......:.|...|||:.:   ....:||||.|.|.|||.|....|| .:|||
  Rat   110 GKP-GCNA-ETCDYFLSYRMIGADVEFELSA---DTDGWVAVGFSSDKKMGGDDVMACVHDDNGR 169

  Fly   301 VNLYSSLTSASPYSAVRSNVNQNSARLLDASIVDGVIYCRVQRDAVTNVQGRTFDLRNGKYHLLV 365
            |.: ....:...::   ..|.:|.||..:....:..:.||.:|...........||....|:|. 
  Rat   170 VRI-QHFYNVGQWA---KEVQRNPARDEEGVFENNRVTCRFKRPVNVPRDETIVDLHLSWYYLF- 229

  Fly   366 ASGSSLKENSVGYHDIGRLP-SAQPINLAEVQDL 398
            |.|.:: :.|:..|||...| |.:.:::.:.:|:
  Rat   230 AWGPAI-QGSITRHDIDSPPASERVVSIYKYEDI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8399NP_001286472.1 Reeler 40..170 CDD:280232
DOMON_SDR_2_like 223..392 CDD:187686 51/179 (28%)
Cyt_b561_FRRS1_like 358..553 CDD:176490 11/42 (26%)
Frrs1lXP_345536.7 DOMON_SDR_2_like 94..253 CDD:187686 50/169 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335027
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.