DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8399 and l(2)34Fc

DIOPT Version :9

Sequence 1:NP_001286472.1 Gene:CG8399 / 36768 FlyBaseID:FBgn0034067 Length:656 Species:Drosophila melanogaster
Sequence 2:NP_001285930.1 Gene:l(2)34Fc / 34838 FlyBaseID:FBgn0261534 Length:159 Species:Drosophila melanogaster


Alignment Length:169 Identity:45/169 - (26%)
Similarity:83/169 - (49%) Gaps:19/169 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LVTALLAVAIWPDPGQSLPQGAPETVCDTMLPFHSGGSVLPQNSVSPFSVETSSSTLGQGQTLRV 78
            ::.|.||:::     .:...|||:..|..:.|.|  |:.| |.:..|:|: :..|.:...|.|.:
  Fly     6 VLAACLAISV-----HAYSDGAPKAACRDLTPQH--GAKL-QVTKPPYSI-SGPSHVRSDQKLTL 61

  Fly    79 DLTGVPAGLSFGGYMIQARNRNPPHQIIGQFGPARDGTIKLMNCENSVNNSATHSNA---GPKQQ 140
            .|    .|..|.|:|||||:..  ::::|||........:.::|... :::.||.:|   .|...
  Fly    62 TL----GGDEFLGFMIQARDGQ--NRVVGQFQVVDSVHSQTLDCSGK-DDTITHLSAQKGKPLTG 119

  Fly   141 VILEWQSPVDFLGQVVFNATIAQSYNEFWVGVPSQPVQI 179
            :..:|..|..:.|.|.|.||:.|:...:|||..::.:.:
  Fly   120 ITFDWIPPAGYKGNVKFMATVVQTGFVYWVGRVTKDIDV 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8399NP_001286472.1 Reeler 40..170 CDD:280232 36/132 (27%)
DOMON_SDR_2_like 223..392 CDD:187686
Cyt_b561_FRRS1_like 358..553 CDD:176490
l(2)34FcNP_001285930.1 Reeler 27..149 CDD:280232 36/132 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446185
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7160
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001198
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45828
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3670
SonicParanoid 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.