DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8399 and Frrs1l

DIOPT Version :9

Sequence 1:NP_001286472.1 Gene:CG8399 / 36768 FlyBaseID:FBgn0034067 Length:656 Species:Drosophila melanogaster
Sequence 2:NP_001136437.1 Gene:Frrs1l / 230235 MGIID:2442704 Length:293 Species:Mus musculus


Alignment Length:231 Identity:60/231 - (25%)
Similarity:98/231 - (42%) Gaps:28/231 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 RRDLSAAPPLPTQSPSAPAGTTRAPYVPPSYVAPNNVVAVSSDPI-------YNGCGQSKNCF-- 236
            |.|..|...:|....|  .||..:.:....|::.......::.|:       ...||::|.||  
Mouse    47 RGDAGADEAVPRHDSS--YGTFASEFYDLRYLSEEGYPFPTAPPVDPFAKIKVEDCGRTKGCFRY 109

  Fly   237 GFPDGCVATKSCTSITVVTVRGDVFEFEIQSGKGTNAAYVAVGLSDDAKMGDDLTTECV-PENGR 300
            |.| ||.| ::|.......:.|...|||:.:   ....:||||.|.|.|||.|....|| .:|||
Mouse   110 GKP-GCNA-ETCDYFLSYRMIGADVEFELSA---DTDGWVAVGFSSDKKMGGDDVMACVHDDNGR 169

  Fly   301 VNLYSSLTSASPYSAVR--SNVNQNSARLLDASIVDGVIYCRVQRDAVTNVQGRTFDLRNGKYHL 363
            |.:...      |:..:  ..|.:|.||..:....:..:.||.:|...........||....|:|
Mouse   170 VRIQHF------YNVGQWAKEVQRNPARDEEGVFENNRVTCRFKRPVNVPRDETIVDLHLSWYYL 228

  Fly   364 LVASGSSLKENSVGYHDIGRLP-SAQPINLAEVQDL 398
            . |.|.:: :.::..|||...| |.:.:::.:.:|:
Mouse   229 F-AWGPAI-QGAITRHDIDSPPASERVVSIYKYEDI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8399NP_001286472.1 Reeler 40..170 CDD:280232
DOMON_SDR_2_like 223..392 CDD:187686 51/181 (28%)
Cyt_b561_FRRS1_like 358..553 CDD:176490 10/42 (24%)
Frrs1lNP_001136437.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..60 4/12 (33%)
DOMON_SDR_2_like 94..253 CDD:187686 50/171 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831295
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.