DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8399 and Y57G11A.4

DIOPT Version :9

Sequence 1:NP_001286472.1 Gene:CG8399 / 36768 FlyBaseID:FBgn0034067 Length:656 Species:Drosophila melanogaster
Sequence 2:NP_502754.3 Gene:Y57G11A.4 / 190363 WormBaseID:WBGene00013292 Length:262 Species:Caenorhabditis elegans


Alignment Length:202 Identity:51/202 - (25%)
Similarity:89/202 - (44%) Gaps:28/202 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 NVVAVSSDPIY---NGCGQSKNCFGFPDGCVATKSCT---SITVVTVRGDVFEFEIQSGKGT--- 271
            :::|..:|.|:   .|||.:|.|...|.||.....||   :::|:...    ..::|....|   
 Worm    10 SLLANLADAIFIDSTGCGTTKMCMFRPRGCDPNLDCTIGVALSVIAPN----RMKVQMVAATIVP 70

  Fly   272 --NAAYVAVGLSDDAKMGDDLTTECVPEN-GRV-----NLYSSLTSASPYSAVRSNVNQNSARLL 328
              ...|||:..|.|..||:|..:|||..| |..     .:|.|.........|..|.::::....
 Worm    71 AVQQQYVAIAFSHDKFMGNDSVSECVISNMGEFVGFEPEVYVSYNKGKSNDRVFLNDDEHAEMFT 135

  Fly   329 D--ASIVDGVIYCRVQRD---AVTNVQGRTFDLRNGKYHLLVASGSSLKENSVGYHDIGRLPSAQ 388
            |  :.:||..:.|...:.   .:.|..|..::| |..::|:.|:||: :.:.|..|::.|...:.
 Worm   136 DLASEVVDTRLVCEFTQQIMPQIDNKNGLIWNL-NSPFYLMAATGSA-QPDEVNVHELNRDSHSF 198

  Fly   389 PINLAEV 395
            ||...|:
 Worm   199 PITSEEM 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8399NP_001286472.1 Reeler 40..170 CDD:280232
DOMON_SDR_2_like 223..392 CDD:187686 49/190 (26%)
Cyt_b561_FRRS1_like 358..553 CDD:176490 11/38 (29%)
Y57G11A.4NP_502754.3 DOMON_SDR_2_like 21..200 CDD:187686 45/184 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156360
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D599276at2759
OrthoFinder 1 1.000 - - FOG0001198
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45828
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.