DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8399 and C44B7.5

DIOPT Version :9

Sequence 1:NP_001286472.1 Gene:CG8399 / 36768 FlyBaseID:FBgn0034067 Length:656 Species:Drosophila melanogaster
Sequence 2:NP_495404.1 Gene:C44B7.5 / 174124 WormBaseID:WBGene00016627 Length:236 Species:Caenorhabditis elegans


Alignment Length:187 Identity:48/187 - (25%)
Similarity:79/187 - (42%) Gaps:29/187 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 KNCFGFPDGCVATKSCTSITVVTVRGDVFEFEIQSGKGTNAAYVAVGLSDDAKMGDDLTTECVPE 297
            |.|.|.|.|||.|:...:.:.:: .|...|.||......:..::|:|.|.|.||.||....|:.:
 Worm    36 KYCVGLPRGCVGTECNFAFSSIS-NGTHTEIEIFGNSVIDKTWLAIGYSADKKMEDDFVVFCIRD 99

  Fly   298 NGRVNLYS-SLTSASPYSAVRSN----------VNQNSARLLDASIV-----DGVIYCRVQRDAV 346
            :...|:.. ...:...|:...||          .|:|....||..:.     :..:||::.. .|
 Worm   100 DAGTNMNKLDQMAGLAYNGKHSNEMTGTIENIKKNKNDKFGLDLEMKEYEKDEQTLYCKMAH-RV 163

  Fly   347 TNVQGRTFDLRNGKYHLLVASGSSLKENSVGYHDIGRLPSAQPINLAEVQDLSGSSR 403
            ..:..| |::  .|..:|:|.|:.:| ..:.||...|       |...:.||||.|:
 Worm   164 EPIIDR-FNV--SKVEILMAKGTWMK-GGLSYHGNTR-------NNTGIIDLSGESK 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8399NP_001286472.1 Reeler 40..170 CDD:280232
DOMON_SDR_2_like 223..392 CDD:187686 42/174 (24%)
Cyt_b561_FRRS1_like 358..553 CDD:176490 14/46 (30%)
C44B7.5NP_495404.1 DOMON_SDR_2_like 26..200 CDD:187686 43/176 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156351
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.