DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8399 and M03A1.3

DIOPT Version :9

Sequence 1:NP_001286472.1 Gene:CG8399 / 36768 FlyBaseID:FBgn0034067 Length:656 Species:Drosophila melanogaster
Sequence 2:NP_494805.3 Gene:M03A1.3 / 173791 WormBaseID:WBGene00019746 Length:352 Species:Caenorhabditis elegans


Alignment Length:294 Identity:67/294 - (22%)
Similarity:103/294 - (35%) Gaps:83/294 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 YCRVQRDAVTNVQGRTFDLRN----------GKYHLLVASGSSLKENSVGYHDIGRLPSAQ---- 388
            :|....::......||.|..|          .|.|:|...|..:..:.....:.|:...||    
 Worm    26 FCYSPNESTKVTLTRTGDSLNLRIYDENSAIRKVHILQKEGKDVLVDCTNKKEDGKTCEAQLTVD 90

  Fly   389 ------PINLAEVQDLSGSS--------------------RLLIQLHGAFMIAAWIGTTSLGIIF 427
                  ||:: ::.|...|.                    |...:.|...||..|:.....|.:|
 Worm    91 QFEKNLPISI-KLSDSQTSDPISLEALVPPAQEGLTKQQRRQFSKAHAILMIFGWLLFVPSGFLF 154

  Fly   428 ARYFKQTWVGSQSCGTDQWFAWHR-------LLMVT-----------TWSLTVAA--YVLIWVEL 472
            ||..|..:......|:..||..||       :.|.|           ||..|.:.  |   |.|:
 Worm   155 ARLGKDLFKEQTLFGSAVWFQIHRAANFMGVVCMCTSMLCIFISTQWTWKGTGSGSKY---WTEV 216

  Fly   473 KQAVWHAHSIIGLITVILCFIQPIGALFRPGPNDKKRPYFNWGHWLGGNLAHILGIVTIFF-SVK 536
                   |:.:|:|:.:|...|||.:|||.||...:|..|||.|...|.:|:.|.:..|.. :|:
 Worm   217 -------HTDLGVISTVLAVAQPINSLFRCGPTHSQRIIFNWAHRCVGIVAYTLALTAIIIAAVQ 274

  Fly   537 LPKAELPEWMDWILVSFVVVHVLVHLIFSIGLCL 570
            ..:......|:.:||           ...|.:||
 Worm   275 FKRIWNEPLMELVLV-----------CLPIAICL 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8399NP_001286472.1 Reeler 40..170 CDD:280232
DOMON_SDR_2_like 223..392 CDD:187686 14/73 (19%)
Cyt_b561_FRRS1_like 358..553 CDD:176490 60/255 (24%)
M03A1.3NP_494805.3 Cyt_b561_FRRS1_like 99..305 CDD:176490 53/221 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156357
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4293
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7160
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D464310at33208
OrthoFinder 1 1.000 - - FOG0001198
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.700

Return to query results.
Submit another query.