DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8399 and si:ch73-196i15.3

DIOPT Version :9

Sequence 1:NP_001286472.1 Gene:CG8399 / 36768 FlyBaseID:FBgn0034067 Length:656 Species:Drosophila melanogaster
Sequence 2:NP_001315196.1 Gene:si:ch73-196i15.3 / 108004537 ZFINID:ZDB-GENE-091116-4 Length:270 Species:Danio rerio


Alignment Length:187 Identity:49/187 - (26%)
Similarity:75/187 - (40%) Gaps:44/187 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 TMLPF---HSGGSVLPQN--------------------SVSPFSVETSSSTLGQGQTLRVDLTGV 83
            |||.|   :|.||:|..:                    :|:|..|...||.:|.|.|:.:..:  
Zfish    15 TMLRFICCYSDGSLLTDHCQSMAIDHGAQASGQDSNPFTVAPDYVIVDSSQVGTGITVTLSAS-- 77

  Fly    84 PAGLSFGGYMIQARNRN--PPHQIIGQFGPARDGTIKLMNCENSVNNSATHSNAGPKQQVILEWQ 146
             :| ||.|:|::||..:  ||   .|.|......::.|  |...|   ..||.:..|..|.:.|.
Zfish    78 -SG-SFMGFMLEARECDDCPP---AGSFSVLDFNSLLL--CSGQV---VAHSLSSDKSSVQVTWT 132

  Fly   147 SPVDFLGQVVFNATIAQSYNEFWVGVPSQPVQIVRRDLSAAPPLPTQSPSAPAGTTR 203
            ...  .||..|.|...:::.|||.     ...|:....:.:||..|...:.|..||:
Zfish   133 PQA--TGQFFFRAAFVKNFIEFWT-----KKAIILSTTTTSPPTTTLMTTTPQTTTQ 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8399NP_001286472.1 Reeler 40..170 CDD:280232 41/152 (27%)
DOMON_SDR_2_like 223..392 CDD:187686
Cyt_b561_FRRS1_like 358..553 CDD:176490
si:ch73-196i15.3NP_001315196.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45828
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.