DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8399 and reeld1

DIOPT Version :9

Sequence 1:NP_001286472.1 Gene:CG8399 / 36768 FlyBaseID:FBgn0034067 Length:656 Species:Drosophila melanogaster
Sequence 2:XP_031751366.1 Gene:reeld1 / 100485235 -ID:- Length:524 Species:Xenopus tropicalis


Alignment Length:277 Identity:63/277 - (22%)
Similarity:104/277 - (37%) Gaps:74/277 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MRSWLATLVTALLAVAI------WPDPGQSLPQGAPETVCDTMLPFHSGGSVLPQNSVSPF-SVE 64
            |.||:...:.|.|.:.:      ......:...||..:.|..|.|.|....  |||....: ::.
 Frog    23 MFSWVEDRIKAQLCLGLACASVCLISYSAAFSHGASLSACSDMRPKHIRAQ--PQNPKKNYIAIR 85

  Fly    65 TSSSTLGQGQTLRVDLTGVPAGLSFGGYMIQARNRNPPHQIIGQFGPARDGTIKLMNCENSVNNS 129
            |:.::...|.|:.|.   :.:...|.|:::||| |....|:.|.|.....|. ||::|... .::
 Frog    86 TNRTSYLPGDTVPVT---IRSSRDFMGFLLQAR-RISNDQVAGSFVFIPPGA-KLLHCFED-GDT 144

  Fly   130 ATHSNAGPKQQVILEWQSPVDFLGQVVFNATIAQSYNEFW---------------------VG-- 171
            .|||:...|:.:...|:||...:|.:.|..::.|||..:|                     ||  
 Frog   145 VTHSDKSLKRNLSFVWKSPDQPVGDIRFFLSVVQSYFVYWSRIESAIVSSKILNNTHASSHVGTS 209

  Fly   172 --VPS-------QPVQ-------------------IVRRDLSAAPPLPTQS------PSAPAGTT 202
              ||:       :|.|                   |....:|.|...|:.:      |....|||
 Frog   210 KTVPTADSAQSWKPEQSSVYLLSVSGLTNVTAANTIALTSVSTAGTKPSTNASKSYKPMMSVGTT 274

  Fly   203 RAPYVPPSYVAPNNVVA 219
            ..|.||.  :..:|::|
 Frog   275 PKPVVPS--LNKSNIIA 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8399NP_001286472.1 Reeler 40..170 CDD:280232 37/151 (25%)
DOMON_SDR_2_like 223..392 CDD:187686
Cyt_b561_FRRS1_like 358..553 CDD:176490
reeld1XP_031751366.1 Reeler 62..184 CDD:396550 36/129 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45828
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.