DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC7 and AT2G25310

DIOPT Version :9

Sequence 1:NP_611078.1 Gene:EMC7 / 36767 FlyBaseID:FBgn0034066 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_180103.2 Gene:AT2G25310 / 817069 AraportID:AT2G25310 Length:210 Species:Arabidopsis thaliana


Alignment Length:194 Identity:55/194 - (28%)
Similarity:97/194 - (50%) Gaps:32/194 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YTIEGRVS-PPDSIFSPTQGGGRSAPVNKNTPKWHTEITLSINDGEFKGFVREDGQFMISGVPSG 97
            |||.|||. ||.::.      |..|.        .:.:.:.:|.|:...|:|.||.|....||:|
plant    39 YTITGRVKIPPSNVI------GHIAK--------FSNVKVILNGGQKITFLRPDGYFTFHEVPAG 89

  Fly    98 SYILDVHHPDVFYEPVRVEINP--KGKFRARKVNFVQPAQIMQVAYPLRVKPLMPFKYFQTREQW 160
            :::::|.....|:.||||:::.  :||.:|..      .:..:....|.::||...:|::.||.:
plant    90 THLIEVSAMGYFFSPVRVDVSARHRGKVQATL------TETRRSLTELVLEPLKEEQYYEIREPF 148

  Fly   161 KITDFLFSPMVLMMVLPLLLMLVLPKMIN--DPETKKEIDNLQFPKMGNDMPEISEMLTSLLTG 222
            .|...:.|||.||:...::::.::||::.  |||..|:... :..:.|  :|.    |||||.|
plant   149 NIMSIVKSPMGLMVGFMVVVVFLMPKLMENIDPEEMKQAQE-EMRRQG--VPS----LTSLLPG 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC7NP_611078.1 DUF2012 68..168 CDD:286513 26/101 (26%)
AT2G25310NP_180103.2 Peptidase_M14NE-CP-C_like 60..158 CDD:419676 27/103 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4164
eggNOG 1 0.900 - - E1_KOG3306
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I2490
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1348328at2759
OrthoFinder 1 1.000 - - FOG0003435
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102814
Panther 1 1.100 - - LDO PTHR13605
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.