DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC7 and emc7

DIOPT Version :9

Sequence 1:NP_611078.1 Gene:EMC7 / 36767 FlyBaseID:FBgn0034066 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001072567.1 Gene:emc7 / 780022 XenbaseID:XB-GENE-945123 Length:237 Species:Xenopus tropicalis


Alignment Length:247 Identity:86/247 - (34%)
Similarity:133/247 - (53%) Gaps:43/247 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ALLALVSCEVII-----GQDELVDEVSGLYTIEGR-----VSPPDSIFSPTQGGGRSAPVNKNTP 64
            |||.|.|.::.:     |.|:        :.:|||     |.|.|                    
 Frog    21 ALLQLCSADLDVLSPGSGSDK--------FKVEGRAVVPGVRPQD-------------------- 57

  Fly    65 KWHTEITLSINDGEFKGFVREDGQFMISGVPSGSYILDVHHPDVFYEPVRVEINPKGKFRARKVN 129
             |.....:.::..|..||:|.||.|::..||||||:::|..|...:|||||:|..|||.|||.||
 Frog    58 -WVNTARVLVDGEEHVGFLRTDGSFVVHDVPSGSYVVEVISPAHRFEPVRVDITSKGKMRARYVN 121

  Fly   130 FVQPAQIMQVAYPLRVKPLMPFKYFQTREQWKITDFLFSPMVLMMVLPLLLMLVLPKMIN--DPE 192
            .::.::::::.|||::|...|..||..||.|..||||.:|||:|||||||:.::|||::|  |||
 Frog   122 HIKTSEVVRLPYPLQMKSSGPPSYFIKRETWGWTDFLMNPMVMMMVLPLLIFVLLPKVVNTSDPE 186

  Fly   193 TKKEID-NLQFPKMGNDMPEISEMLTSLLTGKQPEPKEKKPAPAVRQAKKRK 243
            .::|:: ::.......::|::||.:|.|.|.|. ..|......|.:...||:
 Frog   187 MRREMEQSMNMLNTNPELPDVSEFMTRLFTSKS-SSKSSGSGKAGKSVGKRR 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC7NP_611078.1 DUF2012 68..168 CDD:286513 43/99 (43%)
emc7NP_001072567.1 DUF2012 55..165 CDD:312808 49/130 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..237 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6761
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10597
Inparanoid 1 1.050 144 1.000 Inparanoid score I4345
OMA 1 1.010 - - QHG51947
OrthoDB 1 1.010 - - D1348328at2759
OrthoFinder 1 1.000 - - FOG0003435
OrthoInspector 1 1.000 - - otm47584
Panther 1 1.100 - - LDO PTHR13605
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2915
SonicParanoid 1 1.000 - - X3893
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.