DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC7 and Emc7

DIOPT Version :9

Sequence 1:NP_611078.1 Gene:EMC7 / 36767 FlyBaseID:FBgn0034066 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_598510.1 Gene:Emc7 / 73024 MGIID:1920274 Length:241 Species:Mus musculus


Alignment Length:239 Identity:80/239 - (33%)
Similarity:130/239 - (54%) Gaps:50/239 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FTALLALVSCEVIIGQDELVDEVSGL---------------YTIEGR-----VSPPDSIFSPTQG 52
            |:.||.|:|      .|....||.|.               :.||||     |.|.|        
Mouse     9 FSVLLLLLS------GDAHSSEVPGAAAEGPGGSGVGLGDRFKIEGRAVVPGVKPQD-------- 59

  Fly    53 GGRSAPVNKNTPKWHTEITLSINDGEFKGFVREDGQFMISGVPSGSYILDVHHPDVFYEPVRVEI 117
                         |.:...:.::..|..||::.||.|::..:|||||:::|..|...::||||:|
Mouse    60 -------------WISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVISPAYKFDPVRVDI 111

  Fly   118 NPKGKFRARKVNFVQPAQIMQVAYPLRVKPLMPFKYFQTREQWKITDFLFSPMVLMMVLPLLLML 182
            ..|||.|||.||:::.::::::.|||::|...|..||..||.|..||||.:|||:|||||||:.:
Mouse   112 TSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTDFLMNPMVMMMVLPLLIFV 176

  Fly   183 VLPKMIN--DPETKKEID-NLQFPKMGNDMPEISEMLTSLLTGK 223
            :|||::|  ||:.::|:: ::......:::|::||.:|.|.:.|
Mouse   177 LLPKVVNTSDPDMRREMEQSMNMLNSNHELPDVSEFMTRLFSSK 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC7NP_611078.1 DUF2012 68..168 CDD:286513 40/99 (40%)
Emc7NP_598510.1 DUF2012 56..167 CDD:286513 46/131 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..241 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847607
Domainoid 1 1.000 102 1.000 Domainoid score I6867
eggNOG 1 0.900 - - E1_KOG3306
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10597
Inparanoid 1 1.050 142 1.000 Inparanoid score I4458
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51947
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003435
OrthoInspector 1 1.000 - - oto92120
orthoMCL 1 0.900 - - OOG6_102814
Panther 1 1.100 - - LDO PTHR13605
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2915
SonicParanoid 1 1.000 - - X3893
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.