DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC7 and emc7a

DIOPT Version :9

Sequence 1:NP_611078.1 Gene:EMC7 / 36767 FlyBaseID:FBgn0034066 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001122235.1 Gene:emc7a / 571824 ZFINID:ZDB-GENE-080723-71 Length:259 Species:Danio rerio


Alignment Length:215 Identity:75/215 - (34%)
Similarity:126/215 - (58%) Gaps:15/215 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ALLALVSCEVIIGQDELVDEVSGLYTIEGRVSPPDSIFSPTQGGGRSAPVNKNTPKWHTEITLSI 74
            |||.|........::|..:|:  |...|.||          ...||:.........|.:...:.:
Zfish    13 ALLLLFGLHACFSREEEEEEM--LVHEEMRV----------HVSGRALVPGVRAQDWISSARVLL 65

  Fly    75 NDGEFKGFVREDGQFMISGVPSGSYILDVHHPDVFYEPVRVEINPKGKFRARKVNFVQPAQIMQV 139
            :..:..||:|:||.|.:|.||||||:|::..|...:.||||:|...||.|||.||::|.::::.:
Zfish    66 DGEKHVGFLRDDGSFTVSNVPSGSYVLEISSPTYRFLPVRVDITSAGKMRARVVNYIQTSEVILL 130

  Fly   140 AYPLRVKPLMPFKYFQTREQWKITDFLFSPMVLMMVLPLLLMLVLPKMIN--DPETKKEID-NLQ 201
            .|||:::.:...::|..||.|..|||:.:|||||||||||::|:||::.|  |||.::|:: ::.
Zfish   131 PYPLQMRSVGLHRFFTERESWGWTDFILNPMVLMMVLPLLVILLLPRVFNPSDPEMRREMEQSMN 195

  Fly   202 FPKMGNDMPEISEMLTSLLT 221
            ......::|::||::|.:.|
Zfish   196 MLNSNQELPDVSEIMTKIFT 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC7NP_611078.1 DUF2012 68..168 CDD:286513 38/99 (38%)
emc7aNP_001122235.1 DUF2012 55..164 CDD:286513 42/108 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592958
Domainoid 1 1.000 105 1.000 Domainoid score I6581
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I4394
OMA 1 1.010 - - QHG51947
OrthoDB 1 1.010 - - D1348328at2759
OrthoFinder 1 1.000 - - FOG0003435
OrthoInspector 1 1.000 - - otm24621
orthoMCL 1 0.900 - - OOG6_102814
Panther 1 1.100 - - O PTHR13605
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2915
SonicParanoid 1 1.000 - - X3893
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.940

Return to query results.
Submit another query.