DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC7 and EMC7

DIOPT Version :9

Sequence 1:NP_611078.1 Gene:EMC7 / 36767 FlyBaseID:FBgn0034066 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_064539.1 Gene:EMC7 / 56851 HGNCID:24301 Length:242 Species:Homo sapiens


Alignment Length:246 Identity:80/246 - (32%)
Similarity:133/246 - (54%) Gaps:48/246 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCLKLFVFTALLALVSCEVIIGQDELVDEVSGL---------------YTIEGR-----VSPPDS 45
            |...|:.|..:|.|    :::..|....||.|.               :.||||     |.|.| 
Human     1 MAAALWGFFPVLLL----LLLSGDVQSSEVPGAAAEGSGGSGVGIGDRFKIEGRAVVPGVKPQD- 60

  Fly    46 IFSPTQGGGRSAPVNKNTPKWHTEITLSINDGEFKGFVREDGQFMISGVPSGSYILDVHHPDVFY 110
                                |.:...:.::..|..||::.||.|::..:|||||:::|..|...:
Human    61 --------------------WISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRF 105

  Fly   111 EPVRVEINPKGKFRARKVNFVQPAQIMQVAYPLRVKPLMPFKYFQTREQWKITDFLFSPMVLMMV 175
            :||||:|..|||.|||.||:::.::::::.|||::|...|..||..||.|..||||.:|||:|||
Human   106 DPVRVDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTDFLMNPMVMMMV 170

  Fly   176 LPLLLMLVLPKMIN--DPETKKEID-NLQFPKMGNDMPEISEMLTSLLTGK 223
            ||||:.::|||::|  ||:.::|:: ::......:::|::||.:|.|.:.|
Human   171 LPLLIFVLLPKVVNTSDPDMRREMEQSMNMLNSNHELPDVSEFMTRLFSSK 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC7NP_611078.1 DUF2012 68..168 CDD:286513 40/99 (40%)
EMC7NP_064539.1 DUF2012 57..168 CDD:401403 41/110 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 217..242 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157229
Domainoid 1 1.000 102 1.000 Domainoid score I6907
eggNOG 1 0.900 - - E1_KOG3306
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10597
Inparanoid 1 1.050 142 1.000 Inparanoid score I4479
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51947
OrthoDB 1 1.010 - - D1348328at2759
OrthoFinder 1 1.000 - - FOG0003435
OrthoInspector 1 1.000 - - oto88553
orthoMCL 1 0.900 - - OOG6_102814
Panther 1 1.100 - - LDO PTHR13605
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3893
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.