DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC7 and emc7

DIOPT Version :10

Sequence 1:NP_611078.1 Gene:EMC7 / 36767 FlyBaseID:FBgn0034066 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_595642.1 Gene:emc7 / 2540754 PomBaseID:SPBC83.10 Length:189 Species:Schizosaccharomyces pombe


Alignment Length:194 Identity:44/194 - (22%)
Similarity:77/194 - (39%) Gaps:33/194 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCLKLFVFTALLALVSCEVIIGQDELVDEVSGLYTIEGRVSPPDSIFSPTQGGGRSAPVNKNTPK 65
            |.|..|:..::|....|.    |..|..||.| ..:...:.|..::.|                 
pombe     1 MKLHTFLLLSVLCFAGCI----QQSLQAEVYG-KVLTNTILPKINLLS----------------- 43

  Fly    66 WHTEITLSINDGEFKGFVREDGQFMISGVPSGSYILDVHHPDVFYEPVRVEIN-----PKGKFRA 125
            :.|...|..::..|:..|..||.|....||...|.|.:...|..:....:.||     |.....|
pombe    44 YDTRARLISSNKTFETVVERDGSFTFPNVPDEIYFLRLESIDYEFSEFHIIINESIVYPYYTSPA 108

  Fly   126 RKVNFVQPAQ--IMQVAYPLRVKPLMPFKYFQTREQWKITDFLFSPMVLMMVLPLLLMLVLPKM 187
            .|    :||.  ....:||::|:.::...|.:...::.:...|.|||:|:.:..::|:.:|||:
pombe   109 EK----RPASSTAKNTSYPIKVRAVLKRDYLKEPRKFSLIRLLKSPMMLLSLASVVLVFILPKL 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC7NP_611078.1 EMC7_beta-sandw 68..168 CDD:430607 24/106 (23%)
emc7NP_595642.1 EMC7_beta-sandw 38..154 CDD:430607 28/136 (21%)

Return to query results.
Submit another query.