DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC7 and SPBC83.10

DIOPT Version :9

Sequence 1:NP_611078.1 Gene:EMC7 / 36767 FlyBaseID:FBgn0034066 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_595642.1 Gene:SPBC83.10 / 2540754 PomBaseID:SPBC83.10 Length:189 Species:Schizosaccharomyces pombe


Alignment Length:194 Identity:44/194 - (22%)
Similarity:77/194 - (39%) Gaps:33/194 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCLKLFVFTALLALVSCEVIIGQDELVDEVSGLYTIEGRVSPPDSIFSPTQGGGRSAPVNKNTPK 65
            |.|..|:..::|....|.    |..|..||.| ..:...:.|..::.|                 
pombe     1 MKLHTFLLLSVLCFAGCI----QQSLQAEVYG-KVLTNTILPKINLLS----------------- 43

  Fly    66 WHTEITLSINDGEFKGFVREDGQFMISGVPSGSYILDVHHPDVFYEPVRVEIN-----PKGKFRA 125
            :.|...|..::..|:..|..||.|....||...|.|.:...|..:....:.||     |.....|
pombe    44 YDTRARLISSNKTFETVVERDGSFTFPNVPDEIYFLRLESIDYEFSEFHIIINESIVYPYYTSPA 108

  Fly   126 RKVNFVQPAQ--IMQVAYPLRVKPLMPFKYFQTREQWKITDFLFSPMVLMMVLPLLLMLVLPKM 187
            .|    :||.  ....:||::|:.::...|.:...::.:...|.|||:|:.:..::|:.:|||:
pombe   109 EK----RPASSTAKNTSYPIKVRAVLKRDYLKEPRKFSLIRLLKSPMMLLSLASVVLVFILPKL 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC7NP_611078.1 DUF2012 68..168 CDD:286513 24/106 (23%)
SPBC83.10NP_595642.1 DUF2012 37..154 CDD:286513 29/137 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51947
OrthoFinder 1 1.000 - - FOG0003435
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102814
Panther 1 1.100 - - LDO PTHR13605
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.