DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC7 and C35D10.1

DIOPT Version :9

Sequence 1:NP_611078.1 Gene:EMC7 / 36767 FlyBaseID:FBgn0034066 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001033353.1 Gene:C35D10.1 / 175651 WormBaseID:WBGene00016439 Length:222 Species:Caenorhabditis elegans


Alignment Length:224 Identity:91/224 - (40%)
Similarity:140/224 - (62%) Gaps:21/224 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ALLALVSCEVIIGQDELV---DEVSGLYTIEGRVSPPDSIFSPTQGGGRSAPVNKNTPKWHTEIT 71
            ::|.|.|..|:....|.|   ::.|.|:::||.::.|.:               :|..||.....
 Worm     3 SILLLFSLIVLGSATEEVSRTEQTSTLFSVEGEIALPST---------------RNCAKWSAGAR 52

  Fly    72 LSINDGEFKGFVREDGQFMISGVPSGSYILDVHHPDVFYEPVRVEINPKGKFRARKVNFVQPAQI 136
            :.:|.|::.||||:|..|.:..||:|:||:.:.:.|..:||:||:|..|||.||||:..:||..:
 Worm    53 IHLNHGQYMGFVRQDCTFRVDFVPTGTYIVQIENTDFVFEPIRVDITSKGKMRARKLTILQPNNV 117

  Fly   137 MQVAYPLRVKPLMPFKYFQTREQWKITDFLFSPMVLMMVLPLLLMLVLPKM-INDPETKKEIDNL 200
            ..:.||||:....|.:||:.||:|:|||.||||||||:|:||::||:|||| .||||.|||::|:
 Worm   118 NTLPYPLRLSARGPARYFRKREEWRITDMLFSPMVLMLVVPLVVMLILPKMTANDPELKKEMENM 182

  Fly   201 QFPKMGNDMPEISEMLTSLLTGKQPEPKE 229
            |.||:  |||::.||:.:...|..|..|:
 Worm   183 QMPKV--DMPDVGEMMANFFGGSAPAKKK 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC7NP_611078.1 DUF2012 68..168 CDD:286513 42/99 (42%)
C35D10.1NP_001033353.1 Peptidase_M14NE-CP-C_like 45..149 CDD:304370 44/103 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165395
Domainoid 1 1.000 118 1.000 Domainoid score I3650
eggNOG 1 0.900 - - E1_KOG3306
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10597
Inparanoid 1 1.050 180 1.000 Inparanoid score I2667
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51947
OrthoDB 1 1.010 - - D1348328at2759
OrthoFinder 1 1.000 - - FOG0003435
OrthoInspector 1 1.000 - - oto18210
orthoMCL 1 0.900 - - OOG6_102814
Panther 1 1.100 - - LDO PTHR13605
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2915
SonicParanoid 1 1.000 - - X3893
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.