DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC7 and LOC103909001

DIOPT Version :9

Sequence 1:NP_611078.1 Gene:EMC7 / 36767 FlyBaseID:FBgn0034066 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_021323202.1 Gene:LOC103909001 / 103909001 -ID:- Length:82 Species:Danio rerio


Alignment Length:74 Identity:34/74 - (45%)
Similarity:56/74 - (75%) Gaps:2/74 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 RARKVNFVQPAQIMQVAYPLRVKPLMPFKYFQTREQWKITDFLFSPMVLMMVLPLLLMLVLPKMI 188
            |||.||::|.::::.:.|||:::.:...::|..||.|..|||:.:|||||||||||::|:||::.
Zfish     2 RARVVNYIQTSEVILLPYPLQMRSVGLHRFFTERESWGWTDFILNPMVLMMVLPLLVILLLPRVF 66

  Fly   189 N--DPETKK 195
            |  |||.::
Zfish    67 NPSDPEMRR 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC7NP_611078.1 DUF2012 68..168 CDD:286513 16/43 (37%)
LOC103909001XP_021323202.1 Peptidase_M14NE-CP-C_like <1..51 CDD:328735 19/48 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1348328at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.