DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp42 and RRP45

DIOPT Version :9

Sequence 1:NP_725517.2 Gene:Rrp42 / 36766 FlyBaseID:FBgn0034065 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_010566.1 Gene:RRP45 / 851874 SGDID:S000002688 Length:305 Species:Saccharomyces cerevisiae


Alignment Length:307 Identity:68/307 - (22%)
Similarity:125/307 - (40%) Gaps:49/307 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VALSEAEKTYILHGVEDDFRCDGRSRRDYRPMDLETGLVSNASGSARLRLANTDILVGVKTEIDV 68
            :.:|.:|..:||..:..::|.||||...:|.:::..|   ...|...:::.||.:...:..:|..
Yeast     5 IEISASESKFILEALRQNYRLDGRSFDQFRDVEITFG---KEFGDVSVKMGNTKVHCRISCQIAQ 66

  Fly    69 PNPLTPEFGKLEFFVDCSANATPEFEGRG--GSDLAQELILS--LQNAYESPLAFNYRTLCLIPG 129
            |....|..|......:.|..|..:||...  |.|   |::.|  ::.:.....|.:...||::.|
Yeast    67 PYEDRPFEGLFVISTEISPMAGSQFENGNITGED---EVLCSRIIEKSVRRSGALDVEGLCIVAG 128

  Fly   130 QQCWKLYIDILILECGGNLHDAVSLAAKAALFNTKLPRVTATMLDAGITDLIISDNPYDCTRIGI 194
            .:||.:..|:..|:|.|...||..:|..|.|.:.|.|.:|.    .|...::...|..:...:||
Yeast   129 SKCWAVRADVHFLDCDGGFIDASCIAVMAGLMHFKKPDITV----HGEQIIVHPVNEREPVPLGI 189

  Fly   195 ETVPLLVTVCKI--------------GDYVLVDPSAEEEVCS----TVSM-----VVSVSMRNGQ 236
            ..:|:.||....              .:..::|.:.:||:..    ||::     ||.||.    
Yeast   190 LHIPICVTFSFFNPQDTEENIKGETNSEISIIDATLKEELLRDGVLTVTLNKNREVVQVSK---- 250

  Fly   237 AFLSGTHLTGGGAMHRDTMRNCLELGLAIGEHLDRLLTKMLNLEQQR 283
                    .||..|...|:..|.....:|.|.:...:.::|..:.::
Yeast   251 --------AGGLPMDALTLMKCCHEAYSIIEKITDQILQLLKEDSEK 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp42NP_725517.2 RNase_PH_RRP42 5..278 CDD:206772 67/299 (22%)
Rrp42 6..277 CDD:225034 67/297 (23%)
RRP45NP_010566.1 RNase_PH_RRP45 7..278 CDD:206773 67/292 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.