DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp42 and RRP42

DIOPT Version :9

Sequence 1:NP_725517.2 Gene:Rrp42 / 36766 FlyBaseID:FBgn0034065 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_010172.1 Gene:RRP42 / 851447 SGDID:S000002269 Length:265 Species:Saccharomyces cerevisiae


Alignment Length:244 Identity:63/244 - (25%)
Similarity:122/244 - (50%) Gaps:34/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VALSEAEKTYILHGVED--DFRCDGRSRRDYRPMDLETGLVSNASGSARLRLAN-TDILVGVKTE 65
            ::||.|||:|:...:..  ..|.|||....:||:::.|..:.:::||:|:..:: ::.:|.:|::
Yeast     1 MSLSVAEKSYLYDSLASTPSIRPDGRLPHQFRPIEIFTDFLPSSNGSSRIIASDGSECIVSIKSK 65

  Fly    66 I---DVPNPLTPEFGKLEFFVDCSANATPEFEGRGGSDLAQELILSLQN-AYESPLAFNYRTLCL 126
            :   .|.|.|      |:..||.:        |:....|..|.|.||.| ..:|....:...|.|
Yeast    66 VVDHHVENEL------LQVDVDIA--------GQRDDALVVETITSLLNKVLKSGSGVDSSKLQL 116

  Fly   127 IPGQQCWKLYIDILILECGGNLHDAVSLAAKAALFNTKLPRVTATMLDAGITDLIISDNP----Y 187
            .. :..:|:::|:|::....:....:|.|..:||.:|.||:     |.:...||.:.:.|    |
Yeast   117 TK-KYSFKIFVDVLVISSHSHPVSLISFAIYSALNSTYLPK-----LISAFDDLEVEELPTFHDY 175

  Fly   188 DCTRIGIETVPLLVTVCKIGDYVLVDPSAEEEVCSTVSMVVSVSMRNGQ 236
            |..::.|.. ||:..:..:|:.:|:||:|.|...:...:::|.|  ||:
Yeast   176 DMVKLDINP-PLVFILAVVGNNMLLDPAANESEVANNGLIISWS--NGK 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp42NP_725517.2 RNase_PH_RRP42 5..278 CDD:206772 63/243 (26%)
Rrp42 6..277 CDD:225034 63/242 (26%)
RRP42NP_010172.1 RNase_PH_RRP42 2..264 CDD:206772 63/243 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346700
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2208
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001408
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11097
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1219
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.780

Return to query results.
Submit another query.