DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp42 and RRP43

DIOPT Version :9

Sequence 1:NP_725517.2 Gene:Rrp42 / 36766 FlyBaseID:FBgn0034065 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_009964.2 Gene:RRP43 / 850401 SGDID:S000000631 Length:394 Species:Saccharomyces cerevisiae


Alignment Length:343 Identity:71/343 - (20%)
Similarity:109/343 - (31%) Gaps:139/343 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RSRRDYRPMDLETGLVS------------NASGSARLRLANTDILV----GVKTEIDVPNPLTPE 75
            |...::|.:.:|...:|            |..||..|:...|.::.    |:..|.........:
Yeast    44 RKYEEFRDVAIENNTLSRYADAGNIDTKNNILGSNVLKSGKTIVITSITGGIIEETSAAIKDLDD 108

  Fly    76 FGKLEFF-----VDCSANATPEF------EGRGGSDLAQELILSLQNAYESPLAFNYRTL----- 124
            ||:.|.|     .|..||....:      .||.|:...:|:.:| |..::|.|  :.|.|     
Yeast   109 FGEEELFEVTKEEDIIANYASVYPVVEVERGRVGACTDEEMTIS-QKLHDSIL--HSRILPKKAL 170

  Fly   125 ----------------CLIPGQ--------------QCWK--LYIDILILECGGNLHDAVSLAAK 157
                            .|.|.:              :.|.  ||..|::|...|.:.|....:..
Yeast   171 KVKAGVRSANEDGTFSVLYPDELEDDTLNETNLKMKRKWSYVLYAKIVVLSRTGPVFDLCWNSLM 235

  Fly   158 AALFNTKLPRVTATMLDAGITDL------------------IISDNPYDCTRIGIETVPLLVTVC 204
            .||.:.||||   ..:|...:||                  ||.|.        .::|||::...
Yeast   236 YALQSVKLPR---AFIDERASDLRMTIRTRGRSATIRETYEIICDQ--------TKSVPLMINAK 289

  Fly   205 KI---GDYVLV-----------DPSAEEEV------------------------CSTVSMVVSVS 231
            .|   .:|.:|           |.|.||||                        .||:|::.:.|
Yeast   290 NIAFASNYGIVELDPECQLQNSDNSEEEEVDIDMDKLNTVLIADLDTEAEETSIHSTISILAAPS 354

  Fly   232 MRNGQAFLSGTHLTGGGA 249
            ....|     ..|.||||
Yeast   355 GNYKQ-----LTLVGGGA 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp42NP_725517.2 RNase_PH_RRP42 5..278 CDD:206772 71/343 (21%)
Rrp42 6..277 CDD:225034 71/343 (21%)
RRP43NP_009964.2 RNase_PH 49..388 CDD:206766 70/338 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.