DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp42 and Exosc8

DIOPT Version :9

Sequence 1:NP_725517.2 Gene:Rrp42 / 36766 FlyBaseID:FBgn0034065 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001157042.1 Gene:Exosc8 / 69639 MGIID:1916889 Length:280 Species:Mus musculus


Alignment Length:270 Identity:73/270 - (27%)
Similarity:129/270 - (47%) Gaps:13/270 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YILHGVEDDFRCDGRSRRDYRPMDLETGLVSNASGSARLRLANTDILVGVKTEIDVPNPLTPEFG 77
            |....::::.|.|||...::|...:..|.:|.|.|||.::|.||.::.|||.|...|....|:.|
Mouse    13 YYRRFLKENCRPDGRELGEFRATTVNIGSISTADGSALVKLGNTTVICGVKAEFAAPPVDAPDRG 77

  Fly    78 KLEFF----VDCSANATPEFEGRGGSDLAQELILSLQNAYESPLAFNYRTLCLIPGQQCWKLYID 138
            .:.|.    ||.....:..|......:.||.....:.:..::........||:.||:..|.||.|
Mouse    78 YVVFLSVPNVDLPPLCSSRFRTGPPGEEAQVTSQFIADVVDNSQVIKKEDLCISPGKLAWVLYCD 142

  Fly   139 ILILECGGNLHDAVSLAAKAALFNTKLPRVTATMLDAGITDLIISDNPYDCTRIGIETVPLLVTV 203
            ::.|:..||:.||.:.|..|||.|.:||.||... :..:.::.:....|    :.:.|.|:..:.
Mouse   143 LICLDYDGNILDACTFALLAALKNVQLPEVTINE-ETALAEVNLKKKSY----LNVRTNPVATSF 202

  Fly   204 CKIGDYVL-VDPSAEEEVCSTVSMVVSVSMRNGQAFLSGTHLTGGGAMHRDTMRNCLELGLAIGE 267
            ....|.:| |||:.|||..||.::.| |:..:|:  |...|..||..:....:::|:...:...:
Mouse   203 AVFDDTLLIVDPTGEEEHLSTGTLTV-VTDEDGK--LCCLHKPGGSGLTGAKLQDCMSRAVTRHK 264

  Fly   268 HLDRLLTKML 277
            .:.:||.:::
Mouse   265 EVSKLLDEVI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp42NP_725517.2 RNase_PH_RRP42 5..278 CDD:206772 73/270 (27%)
Rrp42 6..277 CDD:225034 73/268 (27%)
Exosc8NP_001157042.1 RNase_PH_RRP43 6..270 CDD:206774 71/264 (27%)
PRK04282 12..276 CDD:235268 73/270 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001408
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.