DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp42 and exosc8

DIOPT Version :9

Sequence 1:NP_725517.2 Gene:Rrp42 / 36766 FlyBaseID:FBgn0034065 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001007919.1 Gene:exosc8 / 493300 XenbaseID:XB-GENE-961980 Length:276 Species:Xenopus tropicalis


Alignment Length:263 Identity:72/263 - (27%)
Similarity:120/263 - (45%) Gaps:23/263 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RCDGRSRRDYRPMDLETGLVSNASGSARLRLANTDILVGVKTEIDVPNPLTPEFGKLEFFVD--- 84
            |.|||...::|...:..|.::.|.|||.::|.|..:|.|||.|...|....|..|.:...||   
 Frog    23 RPDGRELTEFRTTTINVGSITTADGSALVKLGNCTVLCGVKAEFTAPPADAPNKGYVVPNVDLTP 87

  Fly    85 -CSANATPEFEGRGGSDLAQELILSLQNAYESPLAFNYRTLCLIPGQQCWKLYIDILILECGGNL 148
             ||:...|   |..|.: ||.....:.:..::........||:..|:..|.||.|::.|:..|||
 Frog    88 LCSSQFRP---GPPGEE-AQVASQFIADVIDNSQMLLKEDLCIAHGKLAWVLYCDLICLDYDGNL 148

  Fly   149 HDAVSLAAKAALFNTKLPRVTATMLDAGITDLIISDNPYDCTRIGIETV--PLLVTVCKIGD-YV 210
            .|....|..|||.|.:||.|.... :.|:.::.:.      |:..::.:  |:..:.....| ::
 Frog   149 LDTCMCALVAALQNVRLPSVKINE-ETGLAEVNLK------TKHALKILKHPVATSFAVFDDTFL 206

  Fly   211 LVDPSAEEE-VCSTVSMVVSVSMRNGQAFLSGTHLTGGGAMHRDTMRNCLELGLAIGEHLDRLLT 274
            ||||:.||| :.|.:..||:    :....|..|...||.|:..:.::.|:...:...:.:..||.
 Frog   207 LVDPTGEEEGLASGLLTVVT----DEDERLCATRKPGGSALAAEKLQECISRAITRHKEVTNLLQ 267

  Fly   275 KML 277
            :.|
 Frog   268 EAL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp42NP_725517.2 RNase_PH_RRP42 5..278 CDD:206772 72/263 (27%)
Rrp42 6..277 CDD:225034 71/261 (27%)
exosc8NP_001007919.1 RNase_PH_RRP43 6..266 CDD:206774 69/257 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D447176at33208
OrthoFinder 1 1.000 - - FOG0001408
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.