DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp42 and Rrp45

DIOPT Version :9

Sequence 1:NP_725517.2 Gene:Rrp42 / 36766 FlyBaseID:FBgn0034065 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001285353.1 Gene:Rrp45 / 32665 FlyBaseID:FBgn0030789 Length:412 Species:Drosophila melanogaster


Alignment Length:323 Identity:74/323 - (22%)
Similarity:130/323 - (40%) Gaps:80/323 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SEAEKTYILHGVEDDFRCDGRSRRDYRPMDLETGLVSNASGSARLRLANTDILVGVKTEIDVPNP 71
            |:.|::::...|:.:.|.|||...:.|.::|..|   ...||..:.:.:|.:|..|..|:..|..
  Fly    13 SKPERSFVQLAVKQNQRLDGRRSNESRDVELTFG---KDWGSVAVSMGDTKVLAQVTCEMGPPAL 74

  Fly    72 LTPEFGKLEF--------FVDCSANATPEFEGRGGSDLAQELILSLQNAYESPLAFNYRTLCLIP 128
            ..|..||:..        |:| .|:.|.:       ..:.:|...|:..:.|..:.:..:||:..
  Fly    75 SRPNEGKIHLNVYLGGVAFLD-EAHTTHD-------QRSLKLNSLLERTFRSSRSIDLESLCVAV 131

  Fly   129 GQQCWKLYIDILILECGGNLHDAVSLAAKAALFNTKLPRVTATMLDAGITDLIISDNPYDCTRIG 193
            .:..|.:.:::.:|...|||:||.::|..|||.:.:.|.|.                 |....:.
  Fly   132 EKHVWCIRVNVNVLNHDGNLYDASTIATLAALMHFRRPDVW-----------------YKDGELR 179

  Fly   194 I------ETVPLL-------VTVC--KIGDYVLVDPSAEEEVCSTVSMVVSVSMRNGQAFLSGTH 243
            |      |.:|||       ||.|  |.....::||:..||  :....|:.:|..:.|...|   
  Fly   180 IFKKKEREFIPLLFHHYPVSVTYCVYKSSVQPILDPTLLEE--NAADSVIVLSFNSFQELCS--- 239

  Fly   244 LTGGG----------------AMHRDTMRNCLELGLAIGEH--------LDRLLTKMLNLEQQ 282
            ||.||                |:...::.|.:...||:.|.        :|.|:..:||.|.:
  Fly   240 LTAGGTAPTNARIIMQCARNAAVRCKSLLNFVRKALALDEECRSQGDQSVDGLVALILNTEHK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp42NP_725517.2 RNase_PH_RRP42 5..278 CDD:206772 71/317 (22%)
Rrp42 6..277 CDD:225034 71/316 (22%)
Rrp45NP_001285353.1 RNase_PH_RRP45 13..268 CDD:206773 65/287 (23%)
Rrp42 16..276 CDD:225034 65/292 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472755
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2123
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11097
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.