DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp42 and exosc8

DIOPT Version :9

Sequence 1:NP_725517.2 Gene:Rrp42 / 36766 FlyBaseID:FBgn0034065 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001002865.1 Gene:exosc8 / 323016 ZFINID:ZDB-GENE-030131-1736 Length:277 Species:Danio rerio


Alignment Length:260 Identity:75/260 - (28%)
Similarity:122/260 - (46%) Gaps:9/260 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VEDDFRCDGRSRRDYRPMDLETGLVSNASGSARLRLANTDILVGVKTEIDVPNPLTPEFGKLEFF 82
            ::::.|.|||...::||..|....:|.|.|||.:::.||.::.|:|.|:.||.......|.|...
Zfish    18 LKENCRPDGRELGEFRPTTLNINSISTADGSALVKIGNTTVICGIKAELAVPPSEAQNKGYLVPN 82

  Fly    83 VDCSANATPEFEGRGGSDLAQELILSLQNAYESPLAFNYRTLCLIPGQQCWKLYIDILILECGGN 147
            ||.....:..|......:.||.....:.:..||....|...||:...:.||.||.||:.|:..||
Zfish    83 VDLPPLCSSRFRAGPPGEQAQAASQFIADVIESSDLINLEELCIEKAKLCWVLYCDIMCLDYDGN 147

  Fly   148 LHDAVSLAAKAALFNTKLPRVTATMLDAGITDLIISDNPYDCTRIGIETVPLLVTVCKIGD-YVL 211
            |.||......|||...:||.||... :..:.::.|...    .|:.|...|:..:.....| .::
Zfish   148 LLDACITVLLAALKTAQLPEVTINK-ETDLAEVDIEKK----RRLKINRHPVGSSFAVFDDSIII 207

  Fly   212 VDPSAEEEVCSTVSMVVSVSMRNGQAFLSGTHLTGGGAMHRDTMRNCLELGLAIGEHLDRLLTKM 276
            |||:||||..||..|.|   :.:.:..|...|..||.::..:.:::|:...|...:.:.:||.|:
Zfish   208 VDPTAEEESLSTALMTV---VTDEEDRLCAVHKPGGTSLSGEKLQHCINRALTRNKEIRKLLDKV 269

  Fly   277  276
            Zfish   270  269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp42NP_725517.2 RNase_PH_RRP42 5..278 CDD:206772 75/260 (29%)
Rrp42 6..277 CDD:225034 75/260 (29%)
exosc8NP_001002865.1 RNase_PH_RRP43 6..266 CDD:206774 72/255 (28%)
PRK04282 12..269 CDD:235268 74/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D447176at33208
OrthoFinder 1 1.000 - - FOG0001408
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.