DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp42 and Exosc8

DIOPT Version :9

Sequence 1:NP_725517.2 Gene:Rrp42 / 36766 FlyBaseID:FBgn0034065 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_006232394.1 Gene:Exosc8 / 295050 RGDID:1306169 Length:276 Species:Rattus norvegicus


Alignment Length:266 Identity:70/266 - (26%)
Similarity:125/266 - (46%) Gaps:9/266 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YILHGVEDDFRCDGRSRRDYRPMDLETGLVSNASGSARLRLANTDILVGVKTEIDVPNPLTPEFG 77
            |....::::.|.|||...::|...:..|.:|.|.|||.::|.||.::.|||.|...|....|:.|
  Rat    13 YYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVKAEFAAPPVDAPDRG 77

  Fly    78 KLEFFVDCSANATPEFEGRGGSDLAQELILSLQNAYESPLAFNYRTLCLIPGQQCWKLYIDILIL 142
            .:...||.....:..|......:.||.....:.:..|:........||:.||:..|.||.|::.|
  Rat    78 YVVPNVDLPPLCSSRFRTGPPGEEAQVTSQFIADVIENSQIIKKEDLCISPGKLAWVLYCDLICL 142

  Fly   143 ECGGNLHDAVSLAAKAALFNTKLPRVTATMLDAGITDLIISDNPYDCTRIGIETVPLLVTVCKIG 207
            :..||:.||.:.|..|||.|.:||.||... :..:.::.:....|    :.:...|:..:.....
  Rat   143 DYDGNILDACTFALLAALKNVQLPEVTINE-ETALAEVNLKKKSY----LNVRANPVATSFAVFD 202

  Fly   208 DYVL-VDPSAEEEVCSTVSMVVSVSMRNGQAFLSGTHLTGGGAMHRDTMRNCLELGLAIGEHLDR 271
            |.:| |||:.|||..||.::.|   :.:.:..|...|..||..:....:::|:...:...:.:.:
  Rat   203 DTLLIVDPTGEEEHLSTGTLTV---VMDEEGKLCCLHKPGGSGLTGAKLQDCMSRAVTRHKEVSK 264

  Fly   272 LLTKML 277
            ||.:::
  Rat   265 LLDEVI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp42NP_725517.2 RNase_PH_RRP42 5..278 CDD:206772 70/266 (26%)
Rrp42 6..277 CDD:225034 70/264 (27%)
Exosc8XP_006232394.1 RNase_PH_RRP43 6..266 CDD:206774 68/260 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D447176at33208
OrthoFinder 1 1.000 - - FOG0001408
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.