DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp42 and EXOSC8

DIOPT Version :9

Sequence 1:NP_725517.2 Gene:Rrp42 / 36766 FlyBaseID:FBgn0034065 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_006719826.1 Gene:EXOSC8 / 11340 HGNCID:17035 Length:313 Species:Homo sapiens


Alignment Length:260 Identity:68/260 - (26%)
Similarity:125/260 - (48%) Gaps:9/260 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EDDFRCDGRSRRDYRPMDLETGLVSNASGSARLRLANTDILVGVKTEIDVPNPLTPEFGKLEFFV 83
            :::.|.|||...::|...:..|.:|.|.|||.::|.||.::.|||.|...|:...|:.|.:...|
Human    56 KENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVKAEFAAPSTDAPDKGYVVPNV 120

  Fly    84 DCSANATPEFEGRGGSDLAQELILSLQNAYESPLAFNYRTLCLIPGQQCWKLYIDILILECGGNL 148
            |.....:..|......:.||.....:.:..|:........||:.||:..|.||.|::.|:..||:
Human   121 DLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKEDLCISPGKLVWVLYCDLICLDYDGNI 185

  Fly   149 HDAVSLAAKAALFNTKLPRVTATMLDAGITDLIISDNPYDCTRIGIETVPLLVTVCKIGDYVL-V 212
            .||.:.|..|||.|.:||.||... :..:.::.:....|    :.|.|.|:..:.....|.:| |
Human   186 LDACTFALLAALKNVQLPEVTINE-ETALAEVNLKKKSY----LNIRTHPVATSFAVFDDTLLIV 245

  Fly   213 DPSAEEEVCSTVSMVVSVSMRNGQAFLSGTHLTGGGAMHRDTMRNCLELGLAIGEHLDRLLTKML 277
            ||:.|||..:|.::.:   :.:.:..|...|..||..:....:::|:...:...:.:.:|:.:::
Human   246 DPTGEEEHLATGTLTI---VMDEEGKLCCLHKPGGSGLTGAKLQDCMSRAVTRHKEVKKLMDEVI 307

  Fly   278  277
            Human   308  307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp42NP_725517.2 RNase_PH_RRP42 5..278 CDD:206772 68/260 (26%)
Rrp42 6..277 CDD:225034 68/258 (26%)
EXOSC8XP_006719826.1 RNase_PH_RRP43 56..303 CDD:206774 67/254 (26%)
PRK04282 60..309 CDD:235268 68/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D447176at33208
OrthoFinder 1 1.000 - - FOG0001408
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.