DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8389 and ATG22

DIOPT Version :9

Sequence 1:NP_611076.2 Gene:CG8389 / 36764 FlyBaseID:FBgn0034063 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_009892.1 Gene:ATG22 / 850319 SGDID:S000000543 Length:528 Species:Saccharomyces cerevisiae


Alignment Length:202 Identity:46/202 - (22%)
Similarity:82/202 - (40%) Gaps:66/202 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 WIVVA-AVALINMTNQSILSVFGQLFVGELQKMQEDTFTAALITNLNSLALNFSGLFIGPAIKSF 79
            |.::: ::..||.|  ::|....:|.:..|     :....:::|.:|::.    |.|:.|...:.
Yeast   326 WFIISDSITTINST--AVLFSKAELHMSTL-----NLIMISVLTVVNAML----GAFMIPQFLAT 379

  Fly    80 KPRNVAATGCILVALGLALCAFASESWHFILGYSFFVGFGL------------------GL--IS 124
            |.|..::...:.:.:..:...|     :.|||: ||..|||                  ||  :|
Yeast   380 KFRWTSSQTLMYIIIWASFIPF-----YGILGF-FFNAFGLKHKFEMFLLAIWYGLSLGGLSAVS 438

  Fly   125 PSTFMAI------NSYFT----TKRGRAVGVSLAGAGLGQVLIPHLVRYLLD-NHGFRYA----- 173
            .|.|..|      :::|:    |.:|.::        ||    |.||..|.| .|..||:     
Yeast   439 RSVFSLIVPPGKESTFFSMFSITDKGSSI--------LG----PFLVGLLTDKTHNIRYSFYFFF 491

  Fly   174 VLSMSSL 180
            :|.|.||
Yeast   492 LLLMLSL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8389NP_611076.2 MFS 19..425 CDD:119392 45/199 (23%)
MFS_1 19..400 CDD:284993 45/199 (23%)
ATG22NP_009892.1 MFS_Atg22_like 28..484 CDD:341036 40/186 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11360
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.