DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8389 and Slc16a5

DIOPT Version :9

Sequence 1:NP_611076.2 Gene:CG8389 / 36764 FlyBaseID:FBgn0034063 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001103038.1 Gene:Slc16a5 / 690212 RGDID:1582896 Length:466 Species:Rattus norvegicus


Alignment Length:405 Identity:91/405 - (22%)
Similarity:141/405 - (34%) Gaps:71/405 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DGGYGWIVVAAVALINMTNQSILSVFGQLFVGELQKMQEDTFTAALITNLNSLALNFSGLFIGPA 75
            ||.:.|:|:.|..:.........|..|..|....:..|......:...::....|:..|......
  Rat     9 DGRWAWVVLLASLVTQALTVGFPSCIGVFFTDLQRDFQASNSETSWFPSIMGAMLHCGGPLCSIL 73

  Fly    76 IKSFKPRNVAATGCILVALGLALCAFASESWHFILGYSFFVGFGLGLISPSTFMAINSYFTTKRG 140
            ||.|..|.....|.:|.:||:....|:....|..|......|.|:.....|:...:..||..:|.
  Rat    74 IKRFGCRVTMMLGGVLASLGMVASTFSDSLIHLFLTAGLITGLGMCFSFQSSITVVGLYFVRQRP 138

  Fly   141 RAVGVSLAGAGLGQVLIPHLVRYLLDNHGFRYAVLSMSSLSLFGLFGAAFLKPLNPPAKHNNRKH 205
            .|..::..|..:|..|.|.|.||||:..|:|.|.|....:.|......|.|:|            
  Rat   139 LANALASIGISMGVTLWPLLARYLLETLGWRGAFLIFGGIFLHCCVCGAMLRP------------ 191

  Fly   206 IRLLTEADGEKTSPLQVVIVPTNQSKIERSPPNVDTLCSRMGQRLVQ---AMDLELLKDLVFWSI 267
              :.|..|.|   |.:.:::|         |......|.......:|   |.|: |..::||...
  Rat   192 --VATNVDPE---PKEDLLLP---------PKTPTRSCLATCVSTIQYYLAFDI-LRHNMVFCIY 241

  Fly   268 IVGMALVYTATINFTM--IFPGFLGQTAQLNSQMVAFCMSLVAGADIVFRLLLPIVTDHLRIPYR 330
            :.|...:   |:.|::  ||.........:.....|..||:|...:|                  
  Rat   242 VTGATWM---TLGFSLPHIFLVPYAMHHGMEEYWAAMLMSIVGFCNI------------------ 285

  Fly   331 VVFLIGIVGLFVARCVLA--ENQTLPVIITMSVLTGMMKSATVINNNLTISAHCRSEKLAG---G 390
              ||..:.|:...|..||  ......|.|.::.||.::         .|:||..|  .|.|   .
  Rat   286 --FLRPVAGMLAGRKSLAAYRKYLFAVAILINGLTNLI---------CTVSADFR--VLLGYCLV 337

  Fly   391 LGLSMMSKGVIVITV 405
            ..|||...|::|..|
  Rat   338 YSLSMCGTGILVFQV 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8389NP_611076.2 MFS 19..425 CDD:119392 87/397 (22%)
MFS_1 19..400 CDD:284993 84/390 (22%)
Slc16a5NP_001103038.1 2A0113 1..432 CDD:273325 91/405 (22%)
MFS 32..412 CDD:119392 86/382 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2504
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11360
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.