DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8389 and Slc16a8

DIOPT Version :9

Sequence 1:NP_611076.2 Gene:CG8389 / 36764 FlyBaseID:FBgn0034063 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_113932.2 Gene:Slc16a8 / 65200 RGDID:69282 Length:490 Species:Rattus norvegicus


Alignment Length:487 Identity:108/487 - (22%)
Similarity:177/487 - (36%) Gaps:97/487 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PDGGYGWIVVAAVALIN---MTNQSILSVFGQLFVGELQKMQEDTFTAALITNLNSLALNFSGLF 71
            ||||:||:|:.|..:|.   ......:|||.:....:......||   |.::::....|..:|..
  Rat    13 PDGGWGWVVLGACFVITGFAYGFPKAVSVFFRELKRDFGAGYSDT---AWVSSIMLAMLYGTGPL 74

  Fly    72 IGPAIKSFKPRNVAATGCILVALGLALCAFASESWHFILGYSFFVGFGLGL-ISPSTFMAINSYF 135
            ....:..|..|.|...|.:|.:.|:.|.:|||......|......|.||.| ..||..| :..||
  Rat    75 SSILVTRFGCRPVMLAGGLLASAGMILASFASRLLELYLTAGVLTGLGLALNFQPSLIM-LGLYF 138

  Fly   136 TTKRGRAVGVSLAGAGLGQVLIPHLVRYLLDNHGFRYAVLSMSSLSLFGLFGAAFLKPLNPPAKH 200
            ..:|..|.|::.||:.:....:..|.:.|.:..|:|...|....|.|......|.::|  ||.. 
  Rat   139 ERRRPLANGLAAAGSPVFLSTLSPLGQLLGERFGWRGGFLLFGGLLLHCCACGAVMRP--PPGP- 200

  Fly   201 NNRKHIRLLTEADGEKTSPLQVVIVPTNQSKIERSPPNVDTLCSRMGQRLVQAMDLELLKDLVFW 265
                                        |.:.:.:||.     .|...|  |.:||.:..|..| 
  Rat   201 ----------------------------QPRPDPAPPG-----GRARHR--QLLDLAVCTDRTF- 229

  Fly   266 SIIVGMALVYTATINFTM----IFPGFL----GQTAQLNSQMVAFCMSLVAGADIVFR------- 315
                   :||..| .|.|    ..|..|    .:.|.:.....||.:|:|...|||.|       
  Rat   230 -------MVYMVT-KFLMALGLFVPAILLVNYAKDAGVPDAEAAFLLSIVGFVDIVARPACGALA 286

  Fly   316 ---LLLPIVTDHLRIPYRVVFLIGIVGLFVARCVLAENQTLPVIITMSVLTGMMKSATVINNNLT 377
               .|.|      .:||  :|.:.::...:...:.|..::...::...:..|:............
  Rat   287 GLGRLRP------HVPY--LFSLALLANGLTDLISARARSYGTLVAFCIAFGLSYGMVGALQFEV 343

  Fly   378 ISAHCRSEKLAGGLGLSMMSKGVIVITVGQLLGWVRDYADSYLICLYAQG--VILLVVVLVWTPE 440
            :.|...:.:....|||.::.:.|.|:......|.:.|...:|.|..|..|  |:|..|.:..|  
  Rat   344 LMATVGAPRFPSALGLVLLVEAVAVLIGPPSAGRLVDALKNYEIIFYLAGSEVVLAGVFMAVT-- 406

  Fly   441 ILYRHRRQRC---------ATNKSMETQSIDA 463
               .:..|||         |...:.:|:.::|
  Rat   407 ---TYCCQRCSKDIPPGPSAEGGTSDTEDVEA 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8389NP_611076.2 MFS 19..425 CDD:119392 89/427 (21%)
MFS_1 19..400 CDD:284993 83/402 (21%)
Slc16a8NP_113932.2 2A0113 14..440 CDD:273325 107/486 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2504
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.