DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8389 and zgc:165507

DIOPT Version :9

Sequence 1:NP_611076.2 Gene:CG8389 / 36764 FlyBaseID:FBgn0034063 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001092889.1 Gene:zgc:165507 / 561188 ZFINID:ZDB-GENE-070620-11 Length:394 Species:Danio rerio


Alignment Length:400 Identity:91/400 - (22%)
Similarity:166/400 - (41%) Gaps:56/400 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PDGGYGWIVVAAVALINMTNQSILSVFGQLFVGELQKMQEDTFTAALITNLNSLALNFSGLFIGP 74
            ||||:||.||.. |.|::...........:|..::|::...:::.....:...||:.::|   ||
Zfish    13 PDGGWGWAVVGG-AFISIGFSYAFPKATTVFFKDIQRIFNASYSQVAWISSIMLAVMYAG---GP 73

  Fly    75 ----AIKSFKPRNVAATGCILVALGLALCAFASESWHFILGYSFFVGFGLGL-ISPSTFMAINSY 134
                .:.::..|.:...|..|.|:|:...:|.:......:......|.||.. :.|:..| |..|
Zfish    74 ISSILVNTYGCRPIMILGGFLCAIGMISASFCNNVLELYICIGVIGGLGLAFNLQPALTM-IGRY 137

  Fly   135 FTTKRGRAVGVSLAGAGLGQVLIPHLVRYLLDNHGFRYAVLSMSSLSLFGLFGAAFLKPLNPPAK 199
            |..||..|.|.::||:.:....:..|.:||::.:|:|.:.|.:..|.|......:.::||..|| 
Zfish   138 FYKKRPIANGFAMAGSPVFLSTLAPLNQYLINEYGWRGSFLILGGLLLNCCVAGSLMRPLVAPA- 201

  Fly   200 HNNRKHIRLLTEADGEKTSPLQVVIVPTNQSKIERSPPNVDTLCSRMGQRLVQAMDLELLKD--- 261
                          |....|..|.:....:.|:            ...|.:.:.:||.|.|.   
Zfish   202 --------------GSIAPPPVVEVKHAEKEKL------------TAWQTVNKYLDLSLFKHRGF 240

  Fly   262 LVFWSIIVGMALVYTATINFTMIFPGFLGQTAQLNSQMVAFCMSLVAGADIVFRLLLPIVTD--- 323
            |::.|..|.|.|.:.|.|.|...:....|    ::....||.:|::|..|:..|..:.::.:   
Zfish   241 LIYLSGNVIMFLGFFAPIVFLSPYAKDNG----VDEYQAAFLLSILAFVDMFARPSMGLLANSRW 301

  Fly   324 -HLRIPYRVVFLIGIVGLFVARCVLAENQTLPVIITMSVLTGM---MKSATVINNNLTISAHCRS 384
             ..||.|...|.:...|:....|.|||:.|  .::..:|..|.   |.||.:..   |:.....:
Zfish   302 VRPRIQYFFSFAVLYNGVCHLLCPLAESYT--GMVVYAVFFGFAFGMVSAVLFE---TLMDLVGA 361

  Fly   385 EKLAGGLGLS 394
            ::.:..:||:
Zfish   362 QRFSSAVGLT 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8389NP_611076.2 MFS 19..425 CDD:119392 84/390 (22%)
MFS_1 19..400 CDD:284993 84/390 (22%)
zgc:165507NP_001092889.1 MFS 38..387 CDD:119392 81/373 (22%)
MFS_1 46..383 CDD:284993 80/365 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.