DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8389 and si:dkey-246g23.4

DIOPT Version :9

Sequence 1:NP_611076.2 Gene:CG8389 / 36764 FlyBaseID:FBgn0034063 Length:471 Species:Drosophila melanogaster
Sequence 2:XP_005169996.1 Gene:si:dkey-246g23.4 / 559426 ZFINID:ZDB-GENE-050419-234 Length:457 Species:Danio rerio


Alignment Length:466 Identity:114/466 - (24%)
Similarity:199/466 - (42%) Gaps:62/466 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DGGYGWIVVAAVALINMTNQSILSVFGQLFVGELQKMQEDTFTA-ALITNLNSLALNFSGLFIGP 74
            ||||||.:|.:..|:......::..||..|| |:......|.|| :.||:: |:|....|..:|.
Zfish    16 DGGYGWFIVLSTFLVFGLTFGVIKSFGVFFV-EIHHYFSTTATASSWITSI-SVATVHIGAPVGS 78

  Fly    75 AIKS-FKPRNVAATGCILVALGLALCAFASESWHFILGYSFFVGFGLGLISPSTFMAINSYFTTK 138
            |:.: |..|.|...|.:|.::|:.|.:||.:.....:...|..|||..|....|...:..||..:
Zfish    79 ALSTYFGHRPVVMAGGLLSSVGMVLGSFAQDLLQLYITVGFLTGFGYALTWTPTVTMLGWYFDKR 143

  Fly   139 RGRAVGVSLAGAGLGQVLIPHLVRYLLDNHGFRYAVLSMSSLSLFGLFGAAFLKPLNPPAKHNNR 203
            |..|..:|..|..|...::....:.::|...:|.|:|.:.:|.|......|.|:||   ::|:..
Zfish   144 RPVANALSSTGECLLTFILTPSFQLMVDQFSWRGAMLILGALQLNLCVCGALLRPL---SRHDYF 205

  Fly   204 KHIRLLTEADGEKTSPLQVVIVPTNQSKIERSPPNVDTLCSRMGQRLVQAMDLELLKD---LVFW 265
            |......|.:..|.|          .::.:..|..|         ::::.:|..|:.:   :|:.
Zfish   206 KDSIEENEHELSKCS----------NNRADSDPMKV---------KVIRYVDYTLIANSRFMVYS 251

  Fly   266 SIIVGMALVYTATINFTMIFPGFLGQTAQLNSQMVAFCMSLVAGADIVFRLLLPIVTDHLRIPYR 330
            ...:..||.:.|...|.:.:    .::..:.....|..||:.|..|::.|:....|. :||:...
Zfish   252 MFGIFAALGFFAPSLFLVPY----ARSQGVEEYQAASLMSISAVLDLLGRVFFGWVA-NLRLVET 311

  Fly   331 VVFLIG---IVGLFVARCVLAENQTLPVIITMSVLTGMMKSATVINNNLTISAHCRSEKLAGGLG 392
            |..|||   ::|..:..|.||  .|...:...|...|::..|||..:...::.....|:|...||
Zfish   312 VHQLIGTVVLLGAVLLLCPLA--TTFTQLAVFSAGYGLVFGATVAIHITVLAEVVGVERLGSALG 374

  Fly   393 LSMMSKGVIVITVGQLLG---------WVRDYADSYLICLYAQGVILLV-----VVLVWTPEILY 443
            ..|     ::.:.|.|||         .:.||...:|:.    ||.|||     :||.:..:...
Zfish   375 FFM-----LIRSSGGLLGPPLAGIFIDKMSDYGAGFLMA----GVALLVSALFLIVLHFMNKKET 430

  Fly   444 RHRRQRCATNK 454
            .|::..|:.|:
Zfish   431 EHKKDICSENE 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8389NP_611076.2 MFS 19..425 CDD:119392 98/422 (23%)
MFS_1 19..400 CDD:284993 91/388 (23%)
si:dkey-246g23.4XP_005169996.1 2A0111 10..446 CDD:331689 114/466 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.