DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8389 and CG13907

DIOPT Version :9

Sequence 1:NP_611076.2 Gene:CG8389 / 36764 FlyBaseID:FBgn0034063 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001286894.1 Gene:CG13907 / 38104 FlyBaseID:FBgn0035173 Length:816 Species:Drosophila melanogaster


Alignment Length:270 Identity:79/270 - (29%)
Similarity:125/270 - (46%) Gaps:40/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PDGGYGWIVVAAVALINMTNQSILSVFGQLFVGE-LQKMQEDTFTAALITNLNSLALNFSGLFI- 72
            |||||||::..|..:.||....|...|| :|:.| :....|...|.|.:.:|      .||::: 
  Fly    72 PDGGYGWVICFASFMCNMIVDGIAYTFG-IFLEEFVAYFHEGKGTVAWVGSL------LSGVYLS 129

  Fly    73 -GPAIKS----FKPRNVAATGCILVALGLALCAFASESWHFILGYSFFVGFGLGLISPSTFMAIN 132
             ||.:.:    :..|.|...|.|:..:...|..|::.....:..|.|..|||.|:|.....:|:.
  Fly   130 AGPIVSALANKYGCRAVCIAGSIIACIAFVLSTFSTNVSMLMATYGFMGGFGFGMIYLPAVVAVG 194

  Fly   133 SYFTTKRGRAVGVSLAGAGLGQVLIPHLVRYLLDNHGFRYAVLSMSSLSL-FGLFGAAFLKPLNP 196
            .||.|||..|.|:::.|:|.|......|..|||:.:|::.|:|..:.|.| ..:|| |.::||..
  Fly   195 YYFETKRSLATGIAVCGSGFGTFAFAPLATYLLEEYGWKNALLIFAGLILNCAIFG-AMMRPLTY 258

  Fly   197 PAKHNNRKHIRLLTEADGEKTSPLQ---------VVIVPTNQSKIERS---PPNVDTLCSRMGQR 249
            |.|...:..::.:.|   ||...|:         :|.:|  ...|||.   |.|.|       ..
  Fly   259 PKKKKQKPLMQRMYE---EKQLQLERGSFAGSHFMVQLP--DGTIERKLKMPLNAD-------PG 311

  Fly   250 LVQAMDLELL 259
            :..:::||||
  Fly   312 VHSSLNLELL 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8389NP_611076.2 MFS 19..425 CDD:119392 72/261 (28%)
MFS_1 19..400 CDD:284993 72/261 (28%)
CG13907NP_001286894.1 MFS 78..>258 CDD:119392 55/187 (29%)
MFS <570..748 CDD:119392
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2504
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11360
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.