DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8389 and Slc16a11

DIOPT Version :9

Sequence 1:NP_611076.2 Gene:CG8389 / 36764 FlyBaseID:FBgn0034063 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_694721.2 Gene:Slc16a11 / 216867 MGIID:2663709 Length:447 Species:Mus musculus


Alignment Length:450 Identity:108/450 - (24%)
Similarity:183/450 - (40%) Gaps:107/450 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PDGGYGWIVVAAVALINMTNQSILSVFGQLFVGEL-----QKMQEDTFTAALITNLNSLALNFSG 69
            ||||:||:|.||...:|..:..:|...| |.:.:|     :..|:..:.:||     :||:..:.
Mouse     9 PDGGWGWVVAAAAFAVNGLSYGLLRSLG-LALPDLAEHFERSAQDTAWVSAL-----ALAVQQAA 67

  Fly    70 LFIGPAIKS-FKPRNVAATGCILVALGLALCAFASESWHFILGYSFFVGFGLGLISPSTFMAINS 133
            ..:|.|:.: :..|.|...|.:|.:|||...|||....|..||.....|.|..|:.......::.
Mouse    68 SPVGSALSTRWGARPVVMVGGVLTSLGLVFSAFARSLLHLYLGLGLLAGSGWALVFAPALGTLSR 132

  Fly   134 YFTTKRGRAVGVSLAGAGLGQVLIPHLVRYLLDNHGFRYAVLSMSSLSLFGLFGAAFLKPLNPPA 198
            ||:.:|..|||::|.|.|...:|:...:::|||..|:|.|:|.:.:::|......|.|:||    
Mouse   133 YFSRRRVLAVGLALTGNGASSLLLAPALQFLLDTFGWRGALLLLGAVTLHLTPCGALLRPL---- 193

  Fly   199 KHNNRKHIRLLTEADGEKTSPLQVVIVPTNQSKIERSPPNVDTLCSRMGQRLVQAMDLELLKDLV 263
                        ...|:..:|             .|:|              :.|:.|.|.|...
Mouse   194 ------------ALSGDPLAP-------------PRTP--------------LAALGLGLFKRRA 219

  Fly   264 FWSIIVGMALV---YTATINFTMIFPGFLGQTAQLNSQMVAFCMSLVAGADIVFRLLLPIVTDHL 325
            |....:|.||:   |  .:.:..:.|..|.|  .:.....|..:::.|..|...||....:.|..
Mouse   220 FSVFALGTALIGGGY--FVPYVHLGPHALDQ--GMGGYGAALVVAVAAVGDACARLASGWLADQG 280

  Fly   326 RIPY-RVVFLIG-IVGLFVARCVLA------ENQTLPVI---------------ITMSVLTGMMK 367
            .:|. |::.:.| :.||.|....|.      |....|::               :...||.|::.
Mouse   281 WVPLPRLLVVFGSLTGLGVLAMGLVPTVGTEEGWGAPLLAAAGAYGLSAGSYAPLVFGVLPGLVG 345

  Fly   368 SATVINNNLTISAHCRSEKLAGGLGLSMMSKGVIVITVG-QLLGWVR----DYADSYLIC 422
            ...|:.              |.||.:.:||.|.:   :| .|.|::|    |::.|:|:|
Mouse   346 IGGVVQ--------------ATGLVMMLMSLGGL---LGPPLSGFLRDKTGDFSASFLVC 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8389NP_611076.2 MFS 19..425 CDD:119392 100/440 (23%)
MFS_1 19..400 CDD:284993 92/412 (22%)
Slc16a11NP_694721.2 MFS 14..403 CDD:391944 103/444 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.