DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8389 and SLC16A13

DIOPT Version :9

Sequence 1:NP_611076.2 Gene:CG8389 / 36764 FlyBaseID:FBgn0034063 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_963860.1 Gene:SLC16A13 / 201232 HGNCID:31037 Length:426 Species:Homo sapiens


Alignment Length:433 Identity:102/433 - (23%)
Similarity:173/433 - (39%) Gaps:69/433 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PDGGYGWIVVAAVALINMTNQSILSVFGQLFVGELQKMQEDTFTAALITNLNSLALNFSGLFIGP 74
            ||||:||:||.:....:.....:|..||..||..:...:|.....:.|.:: .:|:...|..:|.
Human     8 PDGGWGWVVVLSAFFQSALVFGVLRSFGVFFVEFVAAFEEQAARVSWIASI-GIAVQQFGSPVGS 71

  Fly    75 AIKS-FKPRNVAATGCILVALGLALCAFASESWHFILGYSFFVGFGLGLISPSTFMAINSYFTTK 138
            |:.: |.||.|..||.||.|||:.|.:||:...|..|......|.|..|....|...::.||:.:
Human    72 ALSTKFGPRPVVMTGGILAALGMLLASFATSLTHLYLSIGLLSGSGWALTFAPTLACLSCYFSRR 136

  Fly   139 RGRAVGVSLAGAGLGQVLIPHLVRYLLDNHGFRYAVLSMSSLSLFGLFGAAFLKP---LNPPAKH 200
            |..|.|::|.|.||.........::||.::.:|.::|.:|:|||..:...|.|:|   ...||..
Human   137 RSLATGLALTGVGLSSFTFAPFFQWLLSHYAWRGSLLLVSALSLHLVACGALLRPPSLAEDPAVG 201

  Fly   201 NNRKHIRLLTEADGEKTSPLQVVIVPTNQSKIERSPPNVDTLCSRMGQRLVQAMDLELLKDLVFW 265
            ..|..:                      .|.:...|                           |.
Human   202 GPRAQL----------------------TSLLHHGP---------------------------FL 217

  Fly   266 SIIVGMALVYTATINFTMIFPGFLGQTAQL-----NSQMVAFCMSLVAGADIVFRLLLPIVTDHL 325
            ...|.:.|:.|.      .|..:|...|.|     :....||.:|:||.:|:|.|::...:.|.:
Human   218 RYTVALTLINTG------YFIPYLHLVAHLQDLDWDPLPAAFLLSVVAISDLVGRVVSGWLGDAV 276

  Fly   326 RIPYRVVFLI--GIVGLFVARCVLAENQTLPVIITMSVLTGMMKSATVINNNLTISAHCRSEKLA 388
            ..|...:.::  .:.|:.:|...:|:..|  .::.::|..|....|........:.....:.::.
Human   277 PGPVTRLLMLWTTLTGVSLALFPVAQAPT--ALVALAVAYGFTSGALAPLAFSVLPELIGTRRIY 339

  Fly   389 GGLGLSMMSKGVIVITVGQLLGWVRDYADSYLICLYAQGVILL 431
            .||||..|.:.:..:....|.|::||...:|.......|..||
Human   340 CGLGLLQMIESIGGLLGPPLSGYLRDVTGNYTASFVVAGAFLL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8389NP_611076.2 MFS 19..425 CDD:119392 92/416 (22%)
MFS_1 19..400 CDD:284993 87/391 (22%)
SLC16A13NP_963860.1 MFS 14..392 CDD:119392 97/427 (23%)
MFS_1 21..357 CDD:284993 86/393 (22%)
DUF3172 369..>419 CDD:288260 4/14 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2504
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.