DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8389 and slc16a5

DIOPT Version :9

Sequence 1:NP_611076.2 Gene:CG8389 / 36764 FlyBaseID:FBgn0034063 Length:471 Species:Drosophila melanogaster
Sequence 2:XP_002940018.3 Gene:slc16a5 / 100485544 XenbaseID:XB-GENE-1008043 Length:455 Species:Xenopus tropicalis


Alignment Length:451 Identity:100/451 - (22%)
Similarity:170/451 - (37%) Gaps:85/451 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PDGGYGWIVVAAVALINMTNQSILSVFGQLFVGELQ-KMQEDTFTAALITNLNSLALNFSGLFIG 73
            |||.:.|:|:|||.|....:....|..| :|..::| ..|......:...::....|:..|....
 Frog     4 PDGPWAWVVLAAVMLTQGLSLGFPSCIG-IFYTDIQTSFQASNTETSWFPSIIMAVLHAGGPLCT 67

  Fly    74 PAIKSFKPRNVAATGCILVALGLALCAFASESWHFILGYSFFVGFGLGLISPSTFMAINSYFTTK 138
            ..::.|..|.....|.:|..:|:...||:....|..|...|..|.|......:....:..||..:
 Frog    68 IMVERFGCRVTVMVGGLLCGVGMVTSAFSQTIIHLYLSAGFVGGLGFCFCFQAGITVLGYYFIRR 132

  Fly   139 RGRAVGVSLAGAGLGQVLIPHLVRYLLDNHGFRYAVLSMSSLSLFGLFGAAFLKP---LNP---- 196
            |..|..::.|||.:|..|.|...::||:..|:|.:.|....:.|......|.::|   |.|    
 Frog   133 RTLANSLASAGASIGMALWPLASQHLLETMGWRGSFLLFGGVLLNCCVCGAIMRPVRSLEPAHEK 197

  Fly   197 ----PAKHNNRKHIRLLTEADGEKTSPLQVVIVPTNQSKIERSPPNVDTLCSRMGQRLVQAMDL- 256
                |.:.|..||       .|||          |.|.|               |.:...|.|| 
 Frog   198 EVLAPEEPNGIKH-------KGEK----------TEQGK---------------GLQRYMAFDLL 230

  Fly   257 ------ELLKDLVFWSIIVGMA-----LVYTATINFTMIFPGFLGQTAQLNSQMVAFCMSLVAGA 310
                  ::....|.| :::|..     ||..||.|             .::.:..|..:|||...
 Frog   231 FRHRRYQIYALGVTW-MVLGFVLPLFYLVPYATSN-------------DIDEKKAALLLSLVGFM 281

  Fly   311 DIVFRLLLPIVTD----HLRIPYRVVFLIGIVGLFVARCVLAENQTLPVIITMSVLTGMMKS--A 369
            :|..|.:..:|:.    |.|:.|  :|.:.::...::..|.|...:.|.::|..||..:..|  .
 Frog   282 NIFMRPMAGLVSQQKVFHGRLMY--LFSVAVILNGLSNLVCAIWVSFPALLTYCVLYSITMSFIG 344

  Fly   370 TVINNNL--TISAHCRSEKLAGGLGLSMMSKGVIVITVGQLLGWVRDYADSYLICLYAQGV 428
            ::|...|  |:.    .::..|..||..:.:.:.::....|.|.:.|....|.:..||..:
 Frog   345 SLIFQVLMDTVG----MKRFPGAFGLFTILESITIMAGPPLAGLLVDITGQYGLVFYASSI 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8389NP_611076.2 MFS 19..425 CDD:119392 93/437 (21%)
MFS_1 19..400 CDD:284993 89/412 (22%)
slc16a5XP_002940018.3 MFS_MCT6 9..414 CDD:340983 97/446 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11360
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.