DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8388 and CG7368

DIOPT Version :9

Sequence 1:NP_611075.1 Gene:CG8388 / 36763 FlyBaseID:FBgn0034062 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_001036599.1 Gene:CG7368 / 39301 FlyBaseID:FBgn0036179 Length:530 Species:Drosophila melanogaster


Alignment Length:222 Identity:50/222 - (22%)
Similarity:75/222 - (33%) Gaps:88/222 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 CTHCEKTYPSQYTMQQHVKLVHLNLYAK-ICDVCGKSIRGREALARHMEEHTGGPQAAIKCHLCD 413
            |..|...||....::.|  ||..||..: :||:|..|::.::.|.||                  
  Fly   330 CPECHVAYPEPELLEVH--LVGHNLEKRYVCDICQASLKRKDHLTRH------------------ 374

  Fly   414 SMLTTKYGLARHIKMMHTAENLQPMQCEFCLKICPSLQAHQHHIKYTHNTARSHQCPMCEKAFKR 478
                                                        |.:||..|.:.|.:|.|||||
  Fly   375 --------------------------------------------KQSHNPERPYICTVCLKAFKR 395

  Fly   479 PNELKEHMTTHTGEVLYTCPHCPQTFNSNANMHAHRKKVHRKEWEENRHKRLNRSRKSDTIIAVS 543
            ..:|..|...|:||..:.|..|.:.|        :||...||      |.|.:.:|:      |.
  Fly   396 KEQLSLHFVIHSGEKRHQCGECGKGF--------YRKDHLRK------HTRSHIARR------VK 440

  Fly   544 VRKTTETRQDGG---LVPAEAIATTSS 567
            ....:..|::.|   |.|....|||::
  Fly   441 AELNSHVRRENGTSMLQPVVTEATTAA 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8388NP_611075.1 zf-AD <21..77 CDD:285071
C2H2 Zn finger 264..281 CDD:275368
C2H2 Zn finger 289..309 CDD:275368
C2H2 Zn finger 320..340 CDD:275368
C2H2 Zn finger 350..369 CDD:275368 5/18 (28%)
C2H2 Zn finger 440..461 CDD:275368 1/20 (5%)
C2H2 Zn finger 469..489 CDD:275368 9/19 (47%)
C2H2 Zn finger 497..515 CDD:275368 3/17 (18%)
CG7368NP_001036599.1 C2H2 Zn finger 330..350 CDD:275368 7/21 (33%)
COG5048 356..>412 CDD:227381 23/117 (20%)
C2H2 Zn finger 358..378 CDD:275368 8/81 (10%)
zf-H2C2_2 370..395 CDD:290200 12/86 (14%)
C2H2 Zn finger 386..406 CDD:275368 9/19 (47%)
zf-H2C2_2 399..423 CDD:290200 8/31 (26%)
zf-C2H2 412..434 CDD:278523 9/35 (26%)
C2H2 Zn finger 414..434 CDD:275368 9/33 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.