DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8388 and CG30020

DIOPT Version :9

Sequence 1:NP_611075.1 Gene:CG8388 / 36763 FlyBaseID:FBgn0034062 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_610627.2 Gene:CG30020 / 36156 FlyBaseID:FBgn0050020 Length:1309 Species:Drosophila melanogaster


Alignment Length:249 Identity:63/249 - (25%)
Similarity:101/249 - (40%) Gaps:48/249 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 IKSRGRLYRCEQCSKAFYSAVVYERHKLTHIPREQWKVPCTHCEKTYPSQYTMQQHVKLVHLNL- 374
            ::|..||:|         |::        ||        |..|.:|:.....:.:|...:|.|. 
  Fly  1075 LRSNSRLHR---------SSI--------HI--------CKLCNQTFDELGKLVKHEMELHSNTE 1114

  Fly   375 -----YAKICDVCGKSIRGREALARHMEEHTGGPQAAIKCHLCDSMLTTKYGLARHIKMMHTAEN 434
                 |...|.:|..|.|....|..||:.|:....   :|.||.....|...|.||.|..|:.: 
  Fly  1115 RSRWGYQHKCAICNTSYRTLTLLKFHMKRHSNRKS---QCKLCPKSFVTIAELERHTKAKHSKD- 1175

  Fly   435 LQPMQCEFCLKICPSLQAHQHHI----KYTHNTARSHQCPMCEKAFKRPNELKEHMTTHTGEVLY 495
             :.::|  .:..|....|.:||:    |.:|.:.| :.||:|.|..|....||.||:.|.||:.|
  Fly  1176 -KTLRC--FMDGCRKTFAFKHHLIRHQKASHLSTR-YICPVCNKEEKSNVHLKNHMSVHKGEITY 1236

  Fly   496 TCPHCPQTFNSNANMHAHRKKVHRKEWEENRHKRL-----NRSRKSDTIIAVSV 544
            .||.|.:::.....:..|...:|...:.......|     |::|.:|..:|..|
  Fly  1237 KCPKCDRSYLRRGRLVTHALIIHDLRFTTEELGNLSSLATNQARPNDLKVATPV 1290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8388NP_611075.1 zf-AD <21..77 CDD:285071
C2H2 Zn finger 264..281 CDD:275368
C2H2 Zn finger 289..309 CDD:275368
C2H2 Zn finger 320..340 CDD:275368 1/19 (5%)
C2H2 Zn finger 350..369 CDD:275368 4/18 (22%)
C2H2 Zn finger 440..461 CDD:275368 6/24 (25%)
C2H2 Zn finger 469..489 CDD:275368 9/19 (47%)
C2H2 Zn finger 497..515 CDD:275368 4/17 (24%)
CG30020NP_610627.2 zf-AD 25..106 CDD:285071
C2H2 Zn finger 369..389 CDD:275368
C2H2 Zn finger 397..418 CDD:275368
C2H2 Zn finger 442..460 CDD:275368
C2H2 Zn finger 730..750 CDD:275368
C2H2 Zn finger 758..777 CDD:275368
C2H2 Zn finger 1089..1110 CDD:275368 4/20 (20%)
C2H2 Zn finger 1124..1144 CDD:275368 7/19 (37%)
C2H2 Zn finger 1151..1172 CDD:275368 8/20 (40%)
C2H2 Zn finger 1180..1203 CDD:275368 6/24 (25%)
C2H2 Zn finger 1210..1230 CDD:275368 9/19 (47%)
C2H2 Zn finger 1238..1254 CDD:275368 3/15 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.