DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8388 and ZK686.5

DIOPT Version :9

Sequence 1:NP_611075.1 Gene:CG8388 / 36763 FlyBaseID:FBgn0034062 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_001023030.2 Gene:ZK686.5 / 3565160 WormBaseID:WBGene00022795 Length:263 Species:Caenorhabditis elegans


Alignment Length:271 Identity:61/271 - (22%)
Similarity:99/271 - (36%) Gaps:67/271 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 REELKSVLEQINL-----------NEIKIE-FPE-ADLTIADVLEDQEEQDFLPDDCISKEGAED 177
            ||.||:..|...|           .|..:| .|| .|.||.     |.::.|..|:..:..|...
 Worm    25 RETLKATKELCELMSHESVGCSCFQEFPVEKAPEMPDFTII-----QPDRKFDGDNAAAVAGIFV 84

  Fly   178 PEVLEKKPPTLKRKVSGRSRGRRRVQLAERPNTSCLPKIQKSQEFNDYIREHYKVQCHICNLPME 242
            ........|:....::.:.  |:.|.     |||    .:|...:.|..|::.:   .|.|:..:
 Worm    85 RSSTSSSFPSASSYIAAKK--RKNVD-----NTS----TRKPYSYKDRKRKNTE---EIRNIKKK 135

  Fly   243 DFSEMLAHVR------REHKQRGYAMCCNRKFLKRGVLVDHLRRHQDPETFKCSICGRVMGHRRS 301
            .|.: |..||      .|.:.|..||  .||..:..|            |..|.:|.:.....:.
 Worm   136 LFMD-LGIVRTNCGIDNEKQDREKAM--KRKVTETIV------------TTYCELCEQNFSSSKM 185

  Fly   302 LELHMRMHEIKSRGRLY-----RCEQCSKAFYSAVVYERHKLTHI-PREQWKVPCTHCEKTYPSQ 360
            |.||        ||:::     .|..|.|.|...:.:.||..||. |..:..|.|..|::.:..:
 Worm   186 LLLH--------RGKVHNTPYIECHLCMKLFSQTIQFNRHMKTHYGPNAKIYVQCELCDRQFKDK 242

  Fly   361 YTMQQHVKLVH 371
            .:::.|..:.|
 Worm   243 QSLRTHWDVSH 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8388NP_611075.1 zf-AD <21..77 CDD:285071
C2H2 Zn finger 264..281 CDD:275368 3/16 (19%)
C2H2 Zn finger 289..309 CDD:275368 5/19 (26%)
C2H2 Zn finger 320..340 CDD:275368 6/19 (32%)
C2H2 Zn finger 350..369 CDD:275368 3/18 (17%)
C2H2 Zn finger 440..461 CDD:275368
C2H2 Zn finger 469..489 CDD:275368
C2H2 Zn finger 497..515 CDD:275368
ZK686.5NP_001023030.2 C2H2 Zn finger 173..194 CDD:275368 7/28 (25%)
C2H2 Zn finger 201..221 CDD:275368 6/19 (32%)
zf-C2H2_8 <204..251 CDD:292531 12/46 (26%)
C2H2 Zn finger 232..248 CDD:275368 2/15 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000909
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.